RESUMEN
The low thermoplasticities of polysaccharide esters make them unsuitable for melt spinning. In this study, we aimed to overcome this problem by mixed esterification of paramylon, a euglenoid ß-1,3-glucan with short- and medium-chain acyl groups, as melt-spinnable materials. Thermal analyses revealed that all the synthesized paramylon mixed esters exhibited glass transition temperatures greater than 100 °C; some of them showed large differences between the melting and 5%-weight-loss temperatures (Td5s) and are extrudable through a spinneret at a temperature ~100 °C below Td5, rendering them potential candidates for the production of melt-spun filaments. Among the various compounds investigated, paramylon acetate propionates, in which the degrees of acetyl- and propionyl-group substitution were 0.5-0.7 and 2.2-2.5, respectively, could be melt-spun to yield mechanically tough crystalline monofilaments. In contrast, the melt spinning of cellulose acetate propionate, analogous to the paramylon acetate propionates in terms of acyl substituents, their substitution degrees, and molecular weights, but differs from it in terms of the glucose linkage mode (i.e., ß-1,3 vs ß-1,4), yielded brittle, charred, and short filaments. Curdlan acetate propionate, another analogue with a degree of polymerization five times larger than that of paramylon mixed esters, was not extrudable due to the lack of thermoplasticity. Therefore, we herein confirmed the superiority of paramylon as a primary raw material for melt-spun filaments.
RESUMEN
The ability to cope successfully with stress is known as 'resilience', and those with resilience are not prone to developing depression. One preclinical animal model for depression is the chronic mild stress (CMS) model. There are CMS-resilient (do not manifest anhedonia) and CMS-susceptible (manifest anhedonia) rats. This study aimed to investigate the differences in the profiles of hippocampal metabolites between susceptible and resilient rats, and to identify a biomarker that can distinguish the two. We divided stress-loaded rats into susceptible and resilient types based on their sucrose preference values. We then conducted brain-derived neurotrophic factor (BDNF) quantification and metabolomic analysis in the hippocampus. Compared to the controls, no significant differences were observed in the hippocampal BDNF levels of susceptible and resilient rats. However, the control rats were clearly distinguishable from the susceptible rats in terms of their brain metabolite profiles; the control rats were difficult to distinguish from the resilient rats. CMS model rats showed an increase in the levels of N-acetylaspartate and glutamate, and a decrease in the levels of aspartate and γ-aminobutyric acid in the hippocampus. Of the 12 metabolites measured in the present study, N-acetylaspartate was the only one that could differentiate the three types (control, susceptible, and resilient) of rats. Thus, brain metabolomic analyses can not only distinguish CMS model rats from control rats, but also indicate stress susceptibility. The variation in the levels of N-acetylaspartate in the hippocampus of control, resilient, and susceptible rats demonstrated that it could be a biomarker for stress susceptibility.
Asunto(s)
Trastorno Depresivo/metabolismo , Hipocampo/metabolismo , Resiliencia Psicológica , Estrés Psicológico/metabolismo , Anhedonia/fisiología , Animales , Ácido Aspártico/análogos & derivados , Ácido Aspártico/metabolismo , Biomarcadores/metabolismo , Factor Neurotrófico Derivado del Encéfalo/metabolismo , Sacarosa en la Dieta , Modelos Animales de Enfermedad , Susceptibilidad a Enfermedades/metabolismo , Preferencias Alimentarias/fisiología , Masculino , Metabolómica , Actividad Motora/fisiología , Ratas WistarRESUMEN
Nicotine-withdrawal symptoms have been indicated as a possible risk factor for neuropsychiatric events, such as depression and suicide, during use of smoking-cessation drugs. We aimed to investigate whether the results of the metabolomic analysis of the rat brain reflect nicotine-withdrawal symptoms. We also aimed to investigate the relative changes in each metabolite in the brains of rats with nicotine-withdrawal symptoms. We created rats experiencing nicotine-withdrawal symptoms through repeat administration of nicotine followed by a 12-h withdrawal period, and rats recovered from nicotine-withdrawal symptoms followed by an 18-h withdrawal period. We then implemented brain metabolic profiling by combining high-resolution magic-angle spinning 1H-NMR spectroscopy with partial least square discriminant analysis (PLS-DA). We found that metabolic profiling of the brain reflects the state during nicotine-withdrawal symptoms and the state after recovery from nicotine-withdrawal symptoms. Additionally, N-acetylaspartate and glutamate increased and aspartate, γ-aminobutyric acid (GABA), and creatine decreased in the hippocampus of rats experiencing nicotine-withdrawal symptoms. Therefore, it is suggested that neurogenesis and neuronal differentiation could be changed and abnormal energy metabolism could occur in the hippocampus during nicotine-withdrawal symptoms.
Asunto(s)
Hipocampo/efectos de los fármacos , Hipocampo/metabolismo , Metaboloma/fisiología , Nicotina/efectos adversos , Síndrome de Abstinencia a Sustancias/metabolismo , Animales , Creatina/metabolismo , Masculino , Ratas , Ratas Wistar , Síndrome de Abstinencia a Sustancias/diagnóstico , Ácido gamma-Aminobutírico/metabolismoRESUMEN
Depressive disorders cause large socioeconomic effects influencing not only the patients themselves but also their family and broader community as well. To better understand the physiologic factors underlying depression, in this study, we performed metabolomics analysis, an omics technique that comprehensively analyzes small molecule metabolites in biological samples. Specifically, we utilized high-resolution magic-angle spinning-1H-NMR (HRMAS-1H-NMR) spectroscopy to comprehensively analyze the changes in metabolites in the hippocampal tissue of rats exposed to chronic stress (CS) via multi-step principal component analysis (multi-step PCA). The rats subjected to CS exhibited obvious depression-like behaviors. High correlations were observed between the first principal component (PC1) score in the score plot obtained using multi-step PCA and measurements from depression-like behavioral testing (body weight, sucrose preference test, and open field test). Alanine, glutamate, glutamine, and aspartate levels in the hippocampal tissue were significantly lower, whereas N-acetylaspartate, myo-inositol, and creatine were significantly higher in the CS group compared to the control (non-CS) group. As alanine, glutamate, and glutamine are known to be involved in energy metabolism, especially in the tricarboxylic acid cycle, chronic exogenous stress may have induced abnormalities in energy metabolism in the brains of the rats. The results suggest that N-acetylaspartate and creatine levels may have increased in order to complement the loss of energy-producing activity resulting from the development of the depression-like disorder. Multi-step PCA therefore allowed an exploration of the degree of depression-like symptoms as represented by changes in intrinsic metabolites.
Asunto(s)
Depresión/metabolismo , Hipocampo/metabolismo , Aminoácidos/metabolismo , Animales , Conducta Animal , Modelos Animales de Enfermedad , Masculino , Metabolómica , Análisis de Componente Principal , Espectroscopía de Protones por Resonancia Magnética/métodos , Ratas , Estrés PsicológicoRESUMEN
BACKGROUND: The circadian clock regulates various physiological and behavioral rhythms such as feeding and locomotor activity. Feeding at unusual times of the day (inactive phase) is thought to be associated with obesity and metabolic disorders in experimental animals and in humans. OBJECTIVE: The present study aimed to determine the underlying mechanisms through which time-of-day-dependent feeding influences metabolic homeostasis. METHODS: We compared food consumption, wheel-running activity, core body temperature, hormonal and metabolic variables in blood, lipid accumulation in the liver, circadian expression of clock and metabolic genes in peripheral tissues, and body weight gain between mice fed only during the sleep phase (DF, daytime feeding) and those fed only during the active phase (NF, nighttime feeding). All mice were fed with the same high-fat high-sucrose diet throughout the experiment. To the best of our knowledge, this is the first study to examine the metabolic effects of time-imposed restricted feeding (RF) in mice with free access to a running wheel. RESULTS: After one week of RF, DF mice gained more weight and developed hyperphagia, higher feed efficiency and more adiposity than NF mice. The daily amount of running on the wheel was rapidly and obviously reduced by DF, which might have been the result of time-of-day-dependent hypothermia. The amount of daily food consumption and hypothalamic mRNA expression of orexigenic neuropeptide Y and agouti-related protein were significantly higher in DF, than in NF mice, although levels of plasma leptin that fluctuate in an RF-dependent circadian manner, were significantly higher in DF mice. These findings suggested that the DF induced leptin resistance. The circadian phases of plasma insulin and ghrelin were synchronized to RF, although the corticosterone phase was unaffected. Peak levels of plasma insulin were remarkably higher in DF mice, although HOMA-IR was identical between the two groups. Significantly more free fatty acids, triglycerides and cholesterol accumulated in the livers of DF, than NF mice, which resulted from the increased expression of lipogenic genes such as Scd1, Acaca, and Fasn. Temporal expression of circadian clock genes became synchronized to RF in the liver but not in skeletal muscle, suggesting that uncoupling metabolic rhythms between the liver and skeletal muscle also contribute to DF-induced adiposity. CONCLUSION: Feeding at an unusual time of day (inactive phase) desynchronizes peripheral clocks and causes obesity and metabolic disorders by inducing leptin resistance, hyperphagia, physical inactivity, hepatic fat accumulation and adiposity.
Asunto(s)
Adiposidad , Conducta Animal , Relojes Circadianos , Métodos de Alimentación/efectos adversos , Hiperfagia/etiología , Enfermedades Metabólicas/etiología , Obesidad/etiología , Tejido Adiposo Blanco/enzimología , Tejido Adiposo Blanco/metabolismo , Tejido Adiposo Blanco/patología , Animales , Regulación del Apetito , Regulación de la Temperatura Corporal , Ingestión de Energía , Metabolismo Energético , Hígado Graso/etiología , Regulación de la Expresión Génica , Hiperfagia/metabolismo , Hiperfagia/fisiopatología , Hipotálamo/metabolismo , Metabolismo de los Lípidos , Hígado/enzimología , Hígado/metabolismo , Hígado/patología , Masculino , Ratones Endogámicos C57BL , Actividad Motora , Músculo Esquelético/enzimología , Músculo Esquelético/metabolismo , Músculo Esquelético/patologíaRESUMEN
This study utilises (1)H NMR-based metabolic profiling to characterise apples of five cultivars grown either in Japan (Fuji, Orin, and Jonagold) or New Zealand (Fuji, Jazz, and Envy). Principal component analysis (PCA) showed a clear separation between the Fuji-Orin-Jonagold class and the Jazz-Envy class, primarily corresponding to the differences in sugar signals, such as sucrose, glucose, and fructose. Multistep PCA removed the influence of dominant sugars and highlighted minor metabolites such as aspartic acid, 2-methylmalate, and an unidentified compound. These minor metabolites separated the apples into two classes according to different geographical areas. Subsequent partial least squares discriminant analysis (PLS-DA) indicated the importance of the unidentified metabolite. This metabolite was isolated using charcoal chromatography, and was identified as L-rhamnitol by 2D NMR and LC/MS analyses. The remarkable contribution of L-rhamnitol to geographic discrimination suggests that apples may be characterised according to various factors, including storage duration, cultivation method, and climate.
Asunto(s)
Espectroscopía de Resonancia Magnética/métodos , Malus/metabolismo , Análisis Discriminante , Japón , Análisis de los Mínimos Cuadrados , Manitol/metabolismo , Espectrometría de Masas/métodos , Metabolómica , Nueva Zelanda , Análisis de Componente PrincipalRESUMEN
Disordered circadian rhythms are associated with various psychiatric conditions and metabolic diseases. We recently established a mouse model of a psychophysiological stress-induced chronic sleep disorder (CSD) characterized by reduced amplitude of circadian wheel-running activity and sleep-wake cycles, sleep fragmentation and hyperphagia. Here, we evaluate day-night fluctuations in plasma concentrations of free amino acids (FAA), appetite hormones and prolactin as well as the hepatic expression of circadian clock-related genes in mice with CSD (CSD mice). Nocturnal increases in wheel-running activity and circadian rhythms of plasma prolactin concentrations were significantly disrupted in CSD mice. Hyperphagia with a decreased leptin/ghrelin ratio was found in CSD mice. Day-night fluctuations in plasma FAA contents were severely disrupted without affecting total FAA levels in CSD mice. Nocturnal increases in branched-chain amino acids such as Ile, Leu, and Val were further augmented in CSD mice, while daytime increases in Gly, Ala, Ser, Thr, Lys, Arg, His, Tyr, Met, Cys, Glu, and Asn were significantly attenuated. Importantly, the circadian expression of hepatic clock genes was completely unaffected in CSD mice. These findings suggest that circadian clock gene expression does not always reflect disordered behavior and sleep rhythms and that plasma FFA profiles could serve as a potential biomarker of circadian rhythm disorders.
Asunto(s)
Aminoácidos/sangre , Proteínas CLOCK/metabolismo , Ritmo Circadiano , Trastornos del Sueño del Ritmo Circadiano/etiología , Trastornos del Sueño del Ritmo Circadiano/metabolismo , Estrés Psicológico/complicaciones , Estrés Psicológico/metabolismo , Animales , Biomarcadores/sangre , Regulación de la Expresión Génica , Masculino , Ratones , Ratones Endogámicos C3H , Reproducibilidad de los Resultados , Sensibilidad y Especificidad , Trastornos del Sueño del Ritmo Circadiano/diagnóstico , Estrés Fisiológico , Estrés Psicológico/diagnósticoRESUMEN
Quantitative analysis of metabolites is important in (1)H-nuclear magnetic resonance (NMR)-based metabolomics of plasma. Human plasma contains a high density of proteins which heavily adsorb the commonly-used standard compound of sodium 3-(trimethylsilyl) propionate 2, 2, 3, 3-d(4) (TSP). We have evaluated calcium formate as an alternative standard in 1D single-pulse (1)H-NMR spectra to quantify plasma metabolites. Formate did not interact with either plasma metabolites or proteins under adequate conditions. Linear relations between the signal intensities and the added formate have been demonstrated in (1)H spectra. The quantifications of glucose and creatinine by this method have shown good accordance with biochemical analysis. Calcium formate is applicable as a concentration standard to NMR metabolomics of plasma.
Asunto(s)
Espectroscopía de Resonancia Magnética/métodos , Metabolómica/métodos , Adulto , Anciano , Anciano de 80 o más Años , Glucemia/análisis , Creatinina/sangre , Femenino , Formiatos/sangre , Humanos , Masculino , Persona de Mediana Edad , Propionatos/sangre , Compuestos de Trimetilsililo/sangreRESUMEN
Blood circulation and the route of nutritional supply both change dramatically in the immediate neonatal period. These systemic shifts lead to adjustment of metabolic patterns in the neonate, with alterations in the spectrum of metabolites in body fluids. We have investigated whether (1)H-NMR-based metabolic profiling (NMR-MP) with principal component analysis (PCA) can be used to evaluate metabolite profiles in highly-diluted samples of individual neonatal mouse urine. We report that a 60-fold dilution of urine gave a reproducible NMR-MP analysis. Here the NMR spectral patterns and PCA score plot clearly delineated the developmental changes in urine metabolites in the immediate neonatal period. These results suggest that NMR-MP may offer a powerful method for assessing the physiology and toxicity of chemicals in neonatal periods of experimental animals.
Asunto(s)
Animales Recién Nacidos/metabolismo , Espectroscopía de Resonancia Magnética/métodos , Animales , Animales Recién Nacidos/crecimiento & desarrollo , Masculino , Metabolómica , Ratones , Ratones Endogámicos C57BL , Análisis de Componente Principal , Reproducibilidad de los Resultados , UrinálisisRESUMEN
Nuclear magnetic resonance-based metabolic profiling (NMR-MP) was applied to evaluate disorder model animals using urine. Diabetic nephropathy was established in this experiment by administering streptozotocin to Wistar rats, which immediately developed diabetes after toxin-treatment and then gradually produced albumin-containing urine (albuminuria). Urine samples were collected for the first 4 weeks after toxin treatment. Predominant urinary sugar signals were seen in (1)H-NMR spectra of diabetes rat urine, and spectra were processed and subjected to multivariate analysis. Principal component analysis (PCA) identified 3 outliers among 20 individuals. Outlier rats did not develop urinary sugar and were later found to be rats insufficient to establish diabetes models. A second PCA was performed excluding the additional glucose-signal region (3.2-6.3 ppm), as glucose signals had a predominant effect that may mask details of other metabolic profiles. Consequently another outlier was revealed. This exceptional rat did not develop albuminuria even after producing glucosuria for 14 weeks. NMR metabolic profiling provides good guidance to evaluate biophysical conditions of animals, enabling detection of abnormalities in the early stage of toxicological experiments.
Asunto(s)
Albuminuria/orina , Diabetes Mellitus Experimental/orina , Nefropatías Diabéticas , Glucosuria/orina , Resonancia Magnética Nuclear Biomolecular/métodos , Análisis de Componente Principal , Animales , Diabetes Mellitus Experimental/inducido químicamente , Diabetes Mellitus Experimental/complicaciones , Nefropatías Diabéticas/complicaciones , Nefropatías Diabéticas/metabolismo , Nefropatías Diabéticas/orina , Masculino , Reconocimiento de Normas Patrones Automatizadas , Ratas , Estreptozocina , UrinálisisRESUMEN
Copper (II) has been implicated in the pathology of Alzheimer's disease (AD) for the impaired homeostatic mechanism found in the brains of AD patients. Here we studied the binding properties of Cu(II) with the first microtubule-binding repeat, encompassing residues 256-273 of the human tau441 sequence. Additionally, the effect of Cu(II) on the assembly of this repeat was also investigated. Our results indicate that Cu(II) can bind to this repeat with His(268) involved and has an inhibiting effect on the in vitro aggregation of this repeat. This work provides new insight into the role of Cu(II) in Alzheimer's disease.
Asunto(s)
Cobre/metabolismo , Fragmentos de Péptidos/metabolismo , Proteínas tau/metabolismo , Enfermedad de Alzheimer/metabolismo , Dicroismo Circular , Cobre/farmacología , Histidina/química , Histidina/metabolismo , Humanos , Espectroscopía de Resonancia Magnética , Fragmentos de Péptidos/síntesis química , Fragmentos de Péptidos/química , Unión Proteica , Conformación Proteica/efectos de los fármacos , Espectrometría de Masa por Láser de Matriz Asistida de Ionización Desorción , Proteínas tau/químicaRESUMEN
UDP-L-rhamnose is required for the biosynthesis of cell wall rhamnogalacturonan-I, rhamnogalacturonan-II, and natural compounds in plants. It has been suggested that the RHM2/MUM4 gene is involved in conversion of UDP-D-glucose to UDP-L-rhamnose on the basis of its effect on rhamnogalacturonan-I-directed development in Arabidopsis thaliana. RHM2/MUM4-related genes, RHM1 and RHM3, can be found in the A. thaliana genome. Here we present direct evidence that all three RHM proteins have UDP-D-glucose 4,6-dehydratase, UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase, and UDP-4-keto-L-rhamnose 4-keto-reductase activities in the cytoplasm when expressed in the yeast Saccharomyces cerevisiae. Functional domain analysis revealed that the N-terminal region of RHM2 (RHM2-N; amino acids 1-370) has the first activity and the C-terminal region of RHM2 (RHM2-C; amino acids 371-667) has the two following activities. This suggests that RHM2 converts UDP-d-glucose to UDP-L-rhamnose via an UDP-4-keto-6-deoxy-D-glucose intermediate. Site-directed mutagenesis of RHM2 revealed that mucilage defects in MUM4-1 and MUM4-2 mutant seeds of A. thaliana are caused by abolishment of RHM2 enzymatic activity in the mutant strains and furthermore, that the GXXGXX(G/A) and YXXXK motifs are important for enzymatic activity. Moreover, a kinetic analysis of purified His(6)-tagged RHM2-N protein revealed 5.9-fold higher affinity of RHM2 for UDP-D-glucose than for dTDP-D-glucose, the preferred substrate for dTDP-D-glucose 4,6-dehydratase from bacteria. RHM2-N activity is strongly inhibited by UDP-L-rhamnose, UDP-D-xylose, and UDP but not by other sugar nucleotides, suggesting that RHM2 maintains cytoplasmic levels of UDP-D-glucose and UDP-L-rhamnose via feedback inhibition by UDP-L-rhamnose and UDP-D-xylose.
Asunto(s)
Proteínas de Arabidopsis/metabolismo , Arabidopsis/enzimología , Pared Celular/metabolismo , Genoma de Planta/fisiología , Complejos Multienzimáticos/metabolismo , Ramnosa/metabolismo , Uridina Difosfato Glucosa/metabolismo , Secuencias de Aminoácidos/genética , Arabidopsis/química , Proteínas de Arabidopsis/química , Proteínas de Arabidopsis/genética , Complejos Multienzimáticos/química , Complejos Multienzimáticos/genética , Mutagénesis Sitio-Dirigida , Pectinas/biosíntesis , Pectinas/química , Pectinas/genética , Ramnosa/química , Ramnosa/genética , Saccharomyces cerevisiae/genética , Semillas/química , Semillas/enzimología , Semillas/genética , Uridina Difosfato Glucosa/química , Uridina Difosfato Glucosa/genética , Uridina Difosfato Xilosa/química , Uridina Difosfato Xilosa/genética , Uridina Difosfato Xilosa/metabolismoRESUMEN
We have previously reported the copper binding properties of R3 peptide (residues 318-335: VTSKCGSLGNIHHKPGGG, according to the longest tau protein) derived from the third repeat microtubule-binding domain of water-soluble tau protein. In this work, we have investigated copper binding properties of R2 peptide (residues 287-304: VQSKCGSKDNIKHVPGGG) derived from the second repeat region of tau protein. Similar to R3 peptide, R2 peptide also plays an important role in the formation of neurofibrillary tangles (NFTs) which is one of the two main biological characteristics of Alzheimer's disease (AD). Based on the copper binding properties of R2 peptide, the possible influences of the binding on the formation of NFTs were investigated. Results from circular dichroism (CD) spectra, nuclear magnetic resonance (NMR) spectroscopy, and matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS) suggest that the binding is pH-dependent and stoichiometry-determined. In addition, these results also reveal that R2 peptide adopts a monomeric alpha-helical structure in aqueous solutions at physiological pH after the addition of 1 mol equiv. of Cu2+. Since alpha-helix structure is responsible for the formation of paired helical filaments (PHFs) which aggregate into NFTs, it is hypothesized that Cu2+ induces R2 peptide to self-assemble into a PHFs-like structure. Hence, it is postulated that Cu2+ plays an important role in the aggregation of R2 peptide and tau protein and that copper binding to R2 peptide may be another possible involvement in AD.
Asunto(s)
Enfermedad de Alzheimer/metabolismo , Cobre/metabolismo , Proteínas tau/química , Proteínas tau/metabolismo , Dicroismo Circular , Humanos , Modelos Moleculares , Resonancia Magnética Nuclear Biomolecular , Fragmentos de Péptidos/química , Fragmentos de Péptidos/genética , Fragmentos de Péptidos/metabolismo , Unión Proteica , Conformación Proteica , Espectrometría de Masa por Láser de Matriz Asistida de Ionización Desorción , Proteínas tau/genéticaRESUMEN
Urine samples were collected during the daytime and nighttime from spontaneously hypertensive model rats and normal rats without dosing. The 1H NMR spectra were measured for their urine samples, and analyzed by a pattern recognition method, known as Principal Component Analysis (PCA) and Soft Independent Modeling of Class Analogy (SIMCA). The separation of urinary data due to the diurnal variation (daytime and nighttime) and also to the difference between the two strains of rat was achieved in the PCA score plot. Differences of the urinary profiles in the respective separation were effectively extracted as marker variables by the SIMCA method. NMR measurements coupled with pattern recognition methods provide a straightforward approach to inspect the disease metabolic status and the preliminary screening tool of marker candidates for further development.
Asunto(s)
Ritmo Circadiano/fisiología , Hipertensión/orina , Espectroscopía de Resonancia Magnética/métodos , Reconocimiento de Normas Patrones Automatizadas/métodos , Animales , Ácido Cítrico/orina , Ácido Láctico/orina , Masculino , Metilaminas/orina , Ácidos Nicotínicos/orina , Análisis de Componente Principal , Ratas , Ratas Endogámicas SHR , Ratas Endogámicas WKY , Ácido Succínico/orinaRESUMEN
Full quantum computation of the electronic state of proteins has recently become possible by the advent of the ab initio fragment molecular orbital (FMO) method. We applied this method to the analysis of the interaction between the Bombyx mori pheromone-binding protein and its ligand, bombykol. The protein-ligand interaction of this molecular complex was minutely analyzed by the FMO method, and the analysis revealed several important interactions between the ligand and amino acid residues.
Asunto(s)
Proteínas Portadoras/metabolismo , Proteínas de Insectos/metabolismo , Animales , Bombyx , Proteínas Portadoras/química , Proteínas de Insectos/química , Ligandos , Modelos Moleculares , Unión ProteicaRESUMEN
As the conversion between the monoionic (1) and diionic (2) form of the phosphate occurs, the phosphorylated peptides or proteins can not only cause the formation of a hydrogen bond between the phosphate group and the amide group but also change the strength of the hydrogen bond to form low-barrier hydrogen bonds (LBHBs). This reversible protonation of the phosphate group, which changes both the electrostatic properties of the phosphate group and the strength of the hydrogen bond, provides a possible mechanism in regulating protein function.
Asunto(s)
Amidas/química , Fosfatos/química , Fosfopéptidos/química , Humanos , Enlace de Hidrógeno , Espectroscopía de Resonancia Magnética , Estructura Molecular , Fosfopéptidos/síntesis química , Proteínas tau/químicaRESUMEN
We developed a means of quantifying proteins that have just localized in the cytoplasmic membrane using 15N-whole cell labeling together with 2D-PAGE and MALDI-TOF MS. The localization of 18 among 20 proteins consisting of 8 lipoproteins, 11 integral membrane proteins having one or two transmembrane segments and one secretory protein in the membrane fractions of Bacillus subtilis, was inhibited by the absence of SecA in a temperature-sensitive mutant. The time course of inhibition indicated that SecA participates in the localization of those proteins through immediately dependent, delayed dependent, and independent ways.
Asunto(s)
Bacillus subtilis/química , Proteínas Bacterianas/análisis , Lipoproteínas/análisis , Proteínas de la Membrana/análisis , Proteómica/métodos , Adenosina Trifosfatasas , Bacillus subtilis/genética , Electroforesis en Gel Bidimensional , Proteínas de Transporte de Membrana , Mutación , Isótopos de Nitrógeno , Transporte de Proteínas , Canales de Translocación SEC , Proteína SecA , Espectrometría de Masa por Láser de Matriz Asistida de Ionización Desorción , TemperaturaRESUMEN
The tau protein plays an important role in some neurodegenerative diseases including Alzheimer's disease (AD). Neurofibrillary tangles (NFTs), a biological marker for AD, are aggregates of bundles of paired helical filaments (PHFs). In general, the alpha-sheet structure favors aberrant protein aggregates. However, some reports have shown that the alpha-helix structure is capable of triggering the formation of aberrant tau protein aggregates and PHFs have a high alpha-helix content. In addition, the third repeat fragment in the four-repeat microtubule-binding domain of the tau protein (residues 306-336: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ, according to the longest tau protein) adopts a helical structure in trifluoroethanol (TFE) and may be a self-assembly model in the tau protein. In the human brain, there is a very small quantity of copper, which performs an important function. In our study, by means of matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS), circular dichroism (CD), and nuclear magnetic resonance (NMR) spectroscopy, the binding properties of copper (II) ion to the R3 peptide derived from the third repeat fragment (residues 318-335: VTSKCGSLGNIHHKPGGG) have been investigated. The results show that copper ions bind to the R3 peptide. CD spectra, ultraviolet (UV)-visible absorption spectra, and MALDI-TOF MS show pH dependence and stoichiometry of Cu2+ binding. Furthermore, CD spectra and NMR spectroscopy elucidate the copper binding sites located in the R3 peptide. Finally, CD spectra reveal that the R3 peptide adopts a mixture structure of random structures, alpha-helices, and beta-turns in aqueous solutions at physiological pH. At pH 7.5, the addition of 0.25 mol eq of Cu2+ induces the conformational change from the mixture mentioned above to a monomeric helical structure, and a beta-sheet structure forms in the presence of 1 mol eq of Cu2+. As alpha-helix and beta-sheet structures are responsible for the formation of PHFs, it is hypothesized that Cu2+ is an inducer of self-assembly of the R3 peptide and makes the R3 peptide form a structure like PHF. Hence, it is postulated that Cu2+ plays an important role in the aggregation of the R3 peptide and tau protein and that copper (II) binding may be another possible involvement in AD.
Asunto(s)
Cobre/metabolismo , Proteínas del Tejido Nervioso/química , Proteínas del Tejido Nervioso/metabolismo , Enfermedad de Alzheimer/metabolismo , Secuencia de Aminoácidos , Dicroismo Circular , Humanos , Concentración de Iones de Hidrógeno , Técnicas In Vitro , Modelos Moleculares , Datos de Secuencia Molecular , Proteínas del Tejido Nervioso/genética , Resonancia Magnética Nuclear Biomolecular , Fragmentos de Péptidos/química , Fragmentos de Péptidos/genética , Fragmentos de Péptidos/metabolismo , Unión Proteica , Conformación Proteica , Espectrometría de Masa por Láser de Matriz Asistida de Ionización Desorción , Proteínas tauRESUMEN
In the brains of Alzheimer's disease patients, the tau protein dissociates from the axonal microtubule and abnormally aggregates to form a paired helical filament (PHF). One of the priorities in Alzheimer research is to determine the effects of abnormal phosphorylation on the local structure. A series of peptides corresponding to isolated regions of tau protein have been successfully synthesized using Fmoc-based chemistry and their conformations were determined by 1H NMR spectroscopy and circular dichroism (CD) spectroscopy. Immunodominant peptides corresponding to tau-(256-273), tau-(350-367) and two phosphorylated derivatives in which a single Ser was phosphorylated at positions 262 and 356, respectively, were the main focus of the study. A direct alteration of the local structure after phosphorylation constitutes a new strategy through which control of biological activity can be enforced. In our study on Ser262 in R1 peptide and Ser356 in R4 peptide, phosphorylation modifies both the negative charge and the local conformation nearby the phosphorylation sites. Together, these structural changes indicate that phosphorylation may act as a conformational switch in the binding domain of tau protein to alter specificity and affinity of binding to microtubule, particularly in response to the abnormal phosphorylation events associated with Alzheimer's disease.