RESUMEN
In the image Gaussian filtering process, convolving with a Gaussian matrix is essential due to the numerous arithmetic computations involved, predominantly multiplications and additions. This can heavily tax the system's memory, particularly with frequent use. To address this issue, a W/Ta2O5/Ag memristor was employed to substantially mitigate the computational overhead associated with convolution operations. Additionally, an interlayer of ZnO was subsequently introduced into the memristor. The resulting Ta2O5/ZnO heterostructure layer exhibited improved linearity in the pulse response, which enhanced linearity facilitates easy adjustment of the conductance magnitude through a linear mapping of the number of pulses and the conductance. Subsequently, the conductance of the W/Ta2O5/ZnO/Ag bilayer memristor was employed as the weights for the convolution kernel in convolution operations. Gaussian noise removal in image processing was achieved by assembling a 5 × 5 memristor array as the kernel. When denoising was performed using memristor arrays, compared to denoising achieved through Gaussian matrix convolution, an average loss of less than 5% was observed. The provided memristors demonstrate significant potential in convolutional computations, particularly for subsequent applications in convolutional neural networks (CNNs).
RESUMEN
Proline 4-hydroxylase 2 (P4HA2) is known for its hydroxylase activity, primarily involved in hydroxylating collagen precursors and promoting collagen cross-linking under physiological conditions. Although its overexpression influences a wide variety of malignant tumors' occurrence and development, its specific effects and mechanisms in oral squamous cell carcinoma (OSCC) remain unclear. This study focused on investigating the expression patterns, carcinogenic functions, and underlying mechanisms of P4HA2 in OSCC cells. Various databases, including TCGA, TIMER, UALCAN, GEPIA, and K-M plotter, along with paraffin-embedded samples, were used to ascertain P4HA2 expression in cancer and its correlation with clinicopathological features. P4HA2 knockdown and overexpression cell models were developed to assess its oncogenic roles and mechanisms. The results indicated that P4HA2 was overexpressed in OSCC and inversely correlated with patient survival. Knockdown of P4HA2 suppressed invasion, migration, and proliferation of OSCC cells both in vitro and in vivo, whereas overexpression of P4HA2 had the opposite effects. Mechanistically, the phosphorylation levels of the PI3K/AKT pathway were reduced following P4HA2 silencing. The study reveals that P4HA2 acts as a promising biomarker for predicting prognosis in OSCC and significantly affects metastasis, invasion, and proliferation of OSCC cells through the regulation of the PI3K/AKT signaling pathway.
Asunto(s)
Carcinoma de Células Escamosas , Movimiento Celular , Proliferación Celular , Neoplasias de la Boca , Invasividad Neoplásica , Fosfatidilinositol 3-Quinasas , Procolágeno-Prolina Dioxigenasa , Proteínas Proto-Oncogénicas c-akt , Transducción de Señal , Animales , Femenino , Humanos , Masculino , Ratones , Persona de Mediana Edad , Carcinoma de Células Escamosas/patología , Carcinoma de Células Escamosas/metabolismo , Carcinoma de Células Escamosas/genética , Línea Celular Tumoral , Movimiento Celular/genética , Regulación Neoplásica de la Expresión Génica , Ratones Desnudos , Neoplasias de la Boca/patología , Neoplasias de la Boca/metabolismo , Neoplasias de la Boca/genética , Metástasis de la Neoplasia , Fosfatidilinositol 3-Quinasas/metabolismo , Procolágeno-Prolina Dioxigenasa/metabolismo , Procolágeno-Prolina Dioxigenasa/genética , Proteínas Proto-Oncogénicas c-akt/metabolismoRESUMEN
As the most common benign vascular tumor in infants, infantile hemangioma (IH) is characterized by rapid growth and vasculogenesis early in infancy, followed by spontaneous involution into fibrofatty tissues over time. Extensive evidence suggests that IH originates from hemangioma stem cells (HemSCs), a group of stem cells with clonal expansion and multi-directional differentiation capacity. However, the intricate mechanisms governing the cell fate transition of HemSCs during IH development remain elusive. Here we comprehensively examine the cellular composition of IH, emphasizing the nuanced properties of various IH cell types and their correlation with the clinical features of the tumor. We also summarize the current understanding of the regulatory pathways directing HemSC differentiation into endothelial cells (ECs), pericytes, and adipocytes throughout the stages of IH progression and involution. Furthermore, we discuss recent advances in unraveling the transcriptional and epigenetic regulation of EC and adipocyte development under physiological conditions, which offer crucial perspectives for understanding IH pathogenesis.
RESUMEN
Porcine circoviruses (PCVs) contain four types: PCV1, PCV2, PCV3, and PCV4, all of which can infect pigs. Among them, PCV1 is non-pathogenic, and PCV2 can cause porcine circovirus diseases (PCVD) or porcine circovirus-associated diseases (PCVAD). Although the pathogenicity of PCV3 and PCV4 is still controversial, increasing evidence shows that PCV3 and PCV4 can cause PCV-related disease. However, mixed infection of PCV2, PCV3, and PCV4 with other pathogens often occurs in large-scale pig breeding, bringing severe economic losses to the global pig industry. In this study, the soluble recombinant proteins of PCV2, PCV3, and PCV4 Cap were expressed by the prokaryotic expression system and biotinylated to combine with the Streptavidin magnetic beads, followed by immunogenicity evaluation of the recombinant proteins. Furthermore, we also assessed the efficacy and immunogenicity of trivalent recombinant proteins conjugated with different adjuvants in mice. The results showed that the highly effective anti-PCV serum was successfully prepared, and the recombinant proteins conjugated with different adjuvants produced various degrees of humoral and cellular immunity in mice. Three recombinant proteins are effective immunogens, and the trivalent proteins coupled with the aluminum adjuvant or GM-CSF-CpG for two-dose immunization can stimulate prominent humoral and cellular immunity against PCVs in vivo. The soluble recombinant proteins are the most promising candidate for developing a trivalent vaccine against PCVs (PCV2, PCV3, and PCV4) infection simultaneously.
Asunto(s)
Proteínas de la Cápside , Infecciones por Circoviridae , Circovirus , Circovirus/inmunología , Circovirus/genética , Animales , Proteínas de la Cápside/genética , Proteínas de la Cápside/inmunología , Infecciones por Circoviridae/veterinaria , Infecciones por Circoviridae/prevención & control , Infecciones por Circoviridae/virología , Infecciones por Circoviridae/inmunología , Porcinos , Ratones , Enfermedades de los Porcinos/virología , Enfermedades de los Porcinos/prevención & control , Enfermedades de los Porcinos/inmunología , Proteínas Recombinantes/inmunología , Femenino , Vacunas Virales/inmunología , Ratones Endogámicos BALB C , Anticuerpos Antivirales/sangreRESUMEN
To determine the association between complement C1q and vulnerable plaque morphology among coronary artery disease (CAD) patients. We conducted a retrospective observational study of 221 CAD patients admitted to The Second Affiliated Hospital of Xi'an Jiaotong University. Intravascular optical coherence tomography was utilized to describe the culprit plaques' morphology. Using logistic regression analysis to explore the correlation between C1q and vulnerable plaques, and receiver operator characteristic (ROC) analysis assess the predictive accuracy. As reported, the complement C1q level was lower in ACS patients than CCS patients (18.25 ± 3.88 vs. 19.18 ± 4.25, P = 0.045). The low complement-C1q-level group was more prone to develop vulnerable plaques. In lipid-rich plaques, the complement C1q level was positively correlated with the thickness of fibrous cap (r = 0.480, P = 0.041). Univariate and multivariate logistic regression analyses suggested that complement C1q could be an independent contributor to plaques' vulnerability. For plaque rupture, erosion, thrombus, and cholesterol crystals, the areas under the ROC curve of complement C1q level were 0.873, 0.816, 0.785, and 0.837, respectively (P < 0.05 for all). In CAD patients, the complement C1q could be a valuable indicator of plaque vulnerability.
Asunto(s)
Complemento C1q , Enfermedad de la Arteria Coronaria , Placa Aterosclerótica , Tomografía de Coherencia Óptica , Humanos , Tomografía de Coherencia Óptica/métodos , Masculino , Femenino , Placa Aterosclerótica/diagnóstico por imagen , Placa Aterosclerótica/patología , Persona de Mediana Edad , Complemento C1q/metabolismo , Complemento C1q/análisis , Enfermedad de la Arteria Coronaria/diagnóstico por imagen , Enfermedad de la Arteria Coronaria/patología , Anciano , Estudios Retrospectivos , Curva ROCRESUMEN
BACKGROUND: This study aims to ascertain the predictive value of platelet and inflammation markers in severe cases of COVID-19. METHODS: A retrospective real-world cohort study was conducted using propensity score matching (PSM). Patients were classified into severe and non-severe COVID-19 groups based on the severity of the disease, and the correlation between severe COVID-19 and laboratory parameters at admission was analyzed. RESULTS: The study included 397 adult patients, comprising 212 (53%) males and 185 (47%) females. Among these, 309 were non-severe and 88 were severe cases. The severe group had a higher median age than the non-severe group (60 vs. 42 years, p < 0.001). Independent risk factors for severe COVID-19 included age, diabetes comorbidity, fever, respiratory symptoms, platelet count, high-sensitivity C-reactive protein (hsCRP), interleukin-6 (IL-6), and the ratio of arterial oxygen partial pressure (PaO2) to the fraction of inspired oxygen (FiO2) (P/F ratio). After one-to-one PSM, adjusted for age, diabetes comorbidities, fever, and respiratory symptoms, significant differences in laboratory parameters at admission were observed. Compared to the non-severe group (n = 71), in the severe group (n = 71), elevated levels of hsCRP (median: 27.1 mg/L vs. 14.6 mg/L, p = 0.005) and IL-6 (median: 16.2 pg/mL vs. 15.3 pg/mL, p = 0.005) were observed, while platelet count (164 ± 36 × 109 vs. 180 ± 50 × 109, p = 0.02) and P/F ratio (median: 351 vs. 397, p = 0.001) were reduced. CONCLUSIONS: Elevated levels of hsCRP and IL-6, along with reduced platelet count and P/F ratio at admission, were significantly associated with severe COVID-19 and may serve as predictive indicators.
Asunto(s)
COVID-19 , Diabetes Mellitus , Masculino , Adulto , Femenino , Humanos , Estudios Retrospectivos , Proteína C-Reactiva , Interleucina-6 , Estudios de Cohortes , Puntaje de Propensión , Inflamación , Oxígeno , Diabetes Mellitus/diagnóstico , Diabetes Mellitus/epidemiologíaRESUMEN
Porcine circovirus 4 (PCV4) is a newly identified virus belonging to PCV of the Circoviridae family, the Circovirus genus. We previously found that PCV4 is pathogenic in vitro, while the virus's replication in cells is still unknown. In this study, we evaluated the N-terminal of the PCV4 capsid (Cap) and identified an NLS at amino acid residues 4-37 of the N-terminus of the PCV4 Cap, 4RSRYSRRRRNRRNQRRRGLWPRASRRRYRWRRKN37. The NLS was further divided into two fragments (NLS-A and NLS-B) based on the predicted structure, including two α-helixes, which were located at 4RSRYSRRRRNRRNQRR19 and 24PRASRRRYRWRRK36, respectively. Further studies showed that the NLS, especially the first α-helixes formed by the NLS-A fragment, determined the nuclear localization of the Cap protein, and the amino acid 4RSRY7 in the NLS of the PCV4 Cap was the critical motif affecting the VLP packaging. These results will provide a theoretical basis for elucidating the infection mechanism of PCV4 and developing subunit vaccines based on VLPs.
Asunto(s)
Circovirus , Señales de Localización Nuclear , Animales , Porcinos , Señales de Localización Nuclear/metabolismo , Cápside/metabolismo , Proteínas de la Cápside/química , Aminoácidos/metabolismoRESUMEN
For stable operation of ultrathin flexible transparent electrodes (uFTEs), it is critical to implement effective risk management during concurrent multi-loading operation of electrical bias and mechanical folding cycles in high-humidity environments. Despite extensive efforts in preparing solution-processed uFTEs with cost-effective and high-throughput means, achieving in-situ nano-adhesion in heterogeneous metal-oxide nanocomposites remains challenging. In this work, we observed by serendipity liquid-like behaviour of transparent metal-oxide-semiconductor zinc oxide nanoparticles (ZnONPs) onto silver nanowires (AgNWs) developed by in-situ solution processed method (iSPM). This enabled us to address the long-standing issue of vulnerability in the nanocomposite caused by the interface of dissimilar materials between AgNWs and ZnONPs, resulting in a remarkably improved multi-loading operation. Importantly, substrate-integrated uFTEs constituted of the metal-oxide nanocomposite electrode semi-embedded in the polymer matrix of greatly thin <0.5 µm thickness is successfully demonstrated with the smooth surface topography, promoted by the tri-system integration including (i) AgNW-AgNW, (ii) ZnONP-ZnONP, and (iii) AgNW-ZnONP systems. Our finding unveils the complex interfacial dynamics associated with the heterogeneous interface system between AgNWs and ZnONPs and holds great promise in understanding the in-situ nano-adhesion process and increasing the design flexibility of next generation solution-processed uFTEs.
RESUMEN
IAVPGEVA, an octapeptide derived from soybean 11S globulin hydrolysis, also known as SGP8, has exhibited regulatory effects on lipid metabolism, inflammation, and fibrosis in vitro. Studies using MCD and HFD-induced nonalcoholic steatohepatitis (NASH) models in mice show that SGP8 attenuates hepatic injury and metabolic disorders. Mechanistic studies suggest that SGP8 inhibits the JNK-c-Jun pathway in L02 cells and liver tissue under metabolic stress and targets DPP4 with DPP4 inhibitory activity. In conclusion, the results suggest that SGP8 is an orally available DPP4-targeting peptide with therapeutic potential in NASH.
Asunto(s)
Globulinas , Enfermedad del Hígado Graso no Alcohólico , Proteínas de Soja , Ratones , Animales , Enfermedad del Hígado Graso no Alcohólico/tratamiento farmacológico , Enfermedad del Hígado Graso no Alcohólico/metabolismo , Dipeptidil Peptidasa 4/metabolismo , Hígado/metabolismo , Globulinas/metabolismo , Ratones Endogámicos C57BL , Modelos Animales de EnfermedadRESUMEN
Infantile hemangioma (IH) is the most prevalent vascular tumor during infancy, characterized by a rapid proliferation phase of disorganized blood vessels and spontaneous involution. IH possibly arises from a special type of multipotent stem cells called hemangioma stem cells (HemSCs), which could differentiate into endothelial cells, pericytes, and adipocytes. However, the underlying mechanisms that regulate the cell fate determination of HemSCs remain elusive. In this study, we unveil KLF2 as a candidate transcription factor involved in the control of HemSCs differentiation. KLF2 exhibits high expression in endothelial cells in proliferating IH but diminishes in adipocytes in involuting IH. Using a combination of in vitro culture of patient-derived HemSCs and HemSCs implantation mouse models, we show that KLF2 governs the proliferation, apoptosis, and cell cycle progression of HemSCs. Importantly, KLF2 acts as a crucial determinant of HemSC fate, directing their differentiation toward endothelial cells while inhibiting adipogenesis. Knockdown of KLF2 induces a proadipogenic transcriptome in HemSCs, leading to impaired blood vessel formation and accelerated adipocyte differentiation. Collectively, our findings highlight KLF2 as a critical regulator controlling the progression and involution of IH by modulating HemSC fate decisions.
Asunto(s)
Diferenciación Celular , Progresión de la Enfermedad , Factores de Transcripción de Tipo Kruppel , Animales , Humanos , Lactante , Masculino , Ratones , Adipocitos/metabolismo , Adipocitos/patología , Adipogénesis/genética , Apoptosis/genética , Proliferación Celular/genética , Células Endoteliales/metabolismo , Células Endoteliales/patología , Hemangioma/patología , Hemangioma/metabolismo , Hemangioma/genética , Hemangioma Capilar/patología , Hemangioma Capilar/metabolismo , Hemangioma Capilar/genética , Factores de Transcripción de Tipo Kruppel/metabolismo , Factores de Transcripción de Tipo Kruppel/genética , Células Madre Neoplásicas/patología , Células Madre Neoplásicas/metabolismo , Neoplasias Cutáneas/patología , Neoplasias Cutáneas/genética , Neoplasias Cutáneas/metabolismoRESUMEN
Capitalizing on rapid carrier migration characteristics and outstanding photoelectric conversion performance, halide perovskite memristors demonstrate an exceptional resistive switching performance. However, they have consistently faced constraints due to material stability issues. This study systematically employs elemental modulation and dimension engineering to effectively control perovskite memristors with different dimensions and A-site elements. Compared to pure 3D and 2D perovskites, the quasi-2D perovskite memristor, specifically BA0.15MA0.85PbI3, is identified as the optimal choice through observations of resistive switching (HRS current < 10-5 A, ON/OFF ratio > 103, endurance cycles > 1000, and retention time > 104 s) and synaptic plasticity characteristics. Subsequently, a comprehensive investigation into various synaptic plasticity aspects, including paired-pulse facilitation (PPF), spike-variability-dependent plasticity (SVDP), spike-rate-dependent plasticity (SRDP), and spike-timing-dependent plasticity (STDP), is conducted. Practical applications, such as memory-forgetting-memory and recognition of the Modified National Institute of Standards and Technology (MNIST) database handwritten data set (accuracy rate reaching 94.8%), are explored and successfully realized. This article provides good theoretical guidance for synaptic-like simulation in perovskite memristors.
RESUMEN
Innate immune receptor TLR4 plays an important role in glycolipid metabolism. The objective of this study is to investigate the inhibitory effects of blocking TLR4 on hyperglycemia and hyperlipidemia by comparing WT and TLR4-/- mice in obesity and diabetes modeling. The knockout of the TLR4 gene could prevent weight gain induced by a high-fat diet (HFD)/high-sugar and high-fat diet (HSHFD), and the differences in the responses existed between the sexes. It extends the time required to reach the obesity criteria. However, when mice were injected with intraperitoneal streptozotocin (STZ) after being fed by HSHFD for two months, TLR4-/- mice exhibited less weight loss than WT. Blocking TLR4 alleviated the changes in body weight and blood glucose, consequently reducing the efficiency of diabetes modeling, especially for male mice. Additionally, male TLR4-/- obese mice exhibit lower total cholesterol (TC) and low-density lipoprotein (LDL) levels in serum and less formation of fat droplets in the liver compared to WT. On the other hand, the knockout of TLR4 significantly increased the high-density lipoprotein (HDL) of male mice. This study should provide new insights into the role of TLR4, as well as opportunities to target novel approaches to the prevention and treatment of metabolic diseases like obesity and diabetes.
RESUMEN
Geranylgeranyltransferase type I (GGTase-I) significantly affects Rho proteins, such that the malignant progression of several cancers may be induced. Nevertheless, the effect and underlying mechanism of GGTase-I in the malignant progression of salivary adenoid cystic carcinoma (SACC) remain unclear. This study primarily aimed to investigate the role and mechanism of GGTase-I in mediating the malignant progression of SACC. The level of GGTase-I gene in cells was stably knocked down by short hairpin RNA-EGFP-lentivirus. The effects of GGTase-I silencing on the migration, invasion, and spread of cells were examined, the messenger RNA levels of GGTase-I and RhoA genes of SACC cells after GGTase-I knockdown were determined, and the protein levels of RhoA and RhoA membrane of SACC cells were analyzed. Moreover, the potential underlying mechanism of silencing GGTase-I on the above-mentioned aspects in SACC cells was assessed by examining the protein expression of ROCK1, MLC, p-MLC, E-cadherin, Vimentin, MMP2, and MMP9. Furthermore, the underlying mechanism of SACC cells proliferation was investigated through the analysis of the expression of cyclinD1, MYC, E2F1, and p21CIP1/WAF1 . Besides, the change of RhoA level in SACC tissues compared with normal paracancer tissues was demonstrated through quantitative reverse-transcription polymerase chain reaction and western blot experiments. Next, the effect after GGTase-I silencing was assessed through the subcutaneous tumorigenicity assay. As indicated by the result of this study, the silencing of GGTase-I significantly reduced the malignant progression of tumors in vivo while decreasing the migration, invasion, and proliferation of SACC cells and RhoA membrane, Vimentin, ROCK1, p-MLC, MMP2, MMP9, MYC, E2F1, and CyclinD1 expression. However, the protein expression of E-cadherin and p21CIP1/WAF1 was notably upregulated. Subsequently, no significant transform of RhoA and MLC proteins was identified. Furthermore, RhoA expression in SACC tissues was significantly higher than that in paracancerous tissues. As revealed by the results of this study, GGTase-I shows a correlation with the proliferation of SACC through the regulation of cell cycle and may take on vital significance in the migration and invasion of SACC by regulating RhoA/ROCK1/MLC signaling pathway. GGTase-I is expected to serve as a novel exploration site of SACC.
Asunto(s)
Transferasas Alquil y Aril , Carcinoma Adenoide Quístico , Neoplasias de las Glándulas Salivales , Quinasas Asociadas a rho , Humanos , Metaloproteinasa 2 de la Matriz/metabolismo , Metaloproteinasa 9 de la Matriz/metabolismo , Vimentina/metabolismo , Carcinoma Adenoide Quístico/genética , Carcinoma Adenoide Quístico/metabolismo , Carcinoma Adenoide Quístico/patología , Neoplasias de las Glándulas Salivales/genética , Neoplasias de las Glándulas Salivales/metabolismo , Neoplasias de las Glándulas Salivales/patología , Invasividad Neoplásica/genética , Puntos de Control del Ciclo Celular , Transducción de Señal , Proliferación Celular , Cadherinas/metabolismo , Línea Celular Tumoral , Movimiento Celular/genética , Regulación Neoplásica de la Expresión GénicaRESUMEN
A crown ether-loaded hybrid adsorbent suitable for the separation and enrichment of strontium from high-level liquid waste was synthesized. 4',4'(5â³)-di(tert-butylcyclohexano)-18-crown-6 (DtBuCH18C6) and its modifiers dodecyl benzenesulfonic acid (DBS) and 1-dodecanol were impregnated into silica-based polymer support. The hybrid adsorbent exhibited excellent Sr(II) selectivity ability, and effective chromatographic separation and recovery of Sr(II) from simulated high-level liquid waste could be achieved with a (DtBuCH18C6 + DBS + dodec)/SiO2-P packed column. The recovery rate of Sr(II) calculated based on the mass balance was approximately 99% and over 80% for the other coexisting metal ions. An appropriate increase in the concentration of Na-DTPA eluent was favorable to improve the efficiency of the elution process because of the increased complexation capacity of [DTPA]5- to Sr(II). The developed theoretical model can simulate the dynamic breakthrough curves of the material on the basis of short column data, thereby predicting the scale-up column of the practical operation. Density functional theory calculation was used to explore the action mechanism of DBS modifiers on the Sr(II) complexation process of crown ether groups. Two Sr(II) complexation isomeric models of DtBuCH18C6 were established, and the calculation results revealed a similar complexation ability. DtBuCH18C6 could form a stable Sr(II) complexation structure with DBS coordination, which further indicated that DBS could be a ligand to promote the Sr(II) adsorption ability of crown ether materials.
RESUMEN
Multivariate time series (MTS) prediction has been studied broadly, which is widely applied in real-world applications. Recently, transformer-based methods have shown the potential in this task for their strong sequence modeling ability. Despite progress, these methods pay little attention to extracting short-term information in the context, while short-term patterns play an essential role in reflecting local temporal dynamics. Moreover, we argue that there are both consistent and specific characteristics among multiple variables, which should be fully considered for MTS modeling. To this end, we propose a multiresolution transformer (MR-Transformer) for MTS prediction, modeling MTS from both the temporal and the variable resolution. Specifically, for the temporal resolution, we design a long short-term transformer. We first split the sequence into nonoverlapping segments in an adaptive way and then extract short-term patterns within segments, while long-term patterns are captured by the inherent attention mechanism. Both of them are aggregated together to capture the temporal dependencies. For the variable resolution, besides the variable-consistent features learned by long short-term transformer, we also design a temporal convolution module to capture the specific features of each variable individually. MR-Transformer enhances the MTS modeling ability by combining multiresolution features between both time steps and variables. Extensive experiments conducted on real-world time series datasets show that MR-Transformer significantly outperforms the state-of-the-art MTS prediction models. The visualization analysis also demonstrates the effectiveness of the proposed model.
RESUMEN
Strontium is a common radionuclide in radioactive waste, and its release into the environment can cause enormous damage to the ecosystem environment. In this study, the natural mineral allophane was selected as the substrate to prepare solidified ceramic products by cold pressing/sintering to solve the problem of the final disposal of radioactive strontium. Ceramic solidified products with various crystal structures were successfully prepared, and the microscopic morphology and energy-dispersive spectroscopy images of the samples showed a uniform distribution of Sr in the solidified products. Sr2Al2SiO7 and SrAl2Si2O8, which can stably solidify strontium, were formed in the solidified products, and the structural characteristics and stability of the above-mentioned substances were analyzed from the perspective of quantum chemical calculations using density functional theory. The calculation results showed that the overall deformation resistance of Sr2Al2SiO7 was higher than that of SrAl2Si2O8. Considering the isomorphic substitution effect of CaO impurities, we inferred that a mixed-crystalline structure of Ca2-xSrxAl2SiO7 may be present in the solidified products.
RESUMEN
INTRODUCTION: Effect of booster vaccination and vitamin D status on antibody production of Omicron variant-infected adults need to be further explored. METHODS: A retrospective, longitudinal, real-world cohort study was performed. All included cases were divided into vitamin D deficiency (VDD) and non-VDD (control) groups according to baseline serum 25-hydroxyvitamin D [25(OH)D] concentration and then into unvaccinated, routinely vaccinated, and booster vaccinated VDD and control subgroups according to vaccination status. Antibody dynamics were observed within six time periods during hospitalization. RESULTS: A total of 204 adult cases were included, of which 121 (59%) were males; 23 (11%), 31 (15%), and 26 (13%) or 50 (25%), 35 (17%), and 39 (19%) were unvaccinated, routinely vaccinated, and booster vaccinated VDD cases or controls, respectively. The median (interquartile range) for age and baseline 25(OH)D concentration was 42.5 (31-53.5) years and 21.5 (18-25.4) ng/mL, respectively. The IgM titers within 3 to 7 days and 7 to 14 days increased rapidly to 1.8-fold (P < 0.001) and 3.6-fold (P < 0.001) those within the first day; the IgG titers increased to 5.8-fold (P < 0.001) and 10.9-fold (P < 0.001). Booster vaccinated controls had higher first IgG titers compared with unvaccinated controls (3.1-fold; P = 0.001) or booster vaccinated VDD cases (2.1-fold; P = 0.02). CONCLUSIONS: Booster vaccination and non-VDD status may have an interactive boosting effect on IgG production of Omicron variant-infected adults. Further randomized clinical trials may be needed to determine whether booster vaccination combined with VDD correction improves the humoral immunity to Omicron variants.
Asunto(s)
Formación de Anticuerpos , Deficiencia de Vitamina D , Masculino , Adulto , Humanos , Femenino , Estudios de Cohortes , Estudios Retrospectivos , Vitamina D , Vitaminas , Deficiencia de Vitamina D/epidemiología , Vacunación , Inmunoglobulina GRESUMEN
Blueberries are rich in phenolic compounds including anthocyanins which are closely related to biological health functions. The purpose of this study was to investigate the antioxidant activity of blueberry anthocyanins extracted from 'Brightwell' rabbiteye blueberries in mice. After one week of adaptation, C57BL/6J healthy male mice were divided into different groups that were administered with 100, 400, or 800 mg/kg blueberry anthocyanin extract (BAE), and sacrificed at different time points (0.1, 0.5, 1, 2, 4, 8, or 12 h). The plasma, eyeball, intestine, liver, and adipose tissues were collected to compare their antioxidant activity, including total antioxidant capacity (T-AOC), superoxide dismutase (SOD) activity and glutathione-peroxidase (GSH-PX/GPX) content, and the oxidative stress marker malondialdehyde (MDA) level. The results showed that blueberry anthocyanins had positive concentration-dependent antioxidant activity in vivo. The greater the concentration of BAE, the higher the T-AOC value, but the lower the MDA level. The enzyme activity of SOD, the content of GSH-PX, and messenger RNA (mRNA) levels of Cu,Zn-SOD, Mn-SOD, and GPX all confirmed that BAE played an antioxidant role after digestion in mice by improving their antioxidant defense. The in vivo antioxidant activity of BAE indicated that blueberry anthocyanins could be developed into functional foods or nutraceuticals with the aim of preventing or treating oxidative stress-related diseases.
Asunto(s)
Antioxidantes , Arándanos Azules (Planta) , Masculino , Ratones , Animales , Antioxidantes/farmacología , Antocianinas/farmacología , Ratones Endogámicos C57BL , Superóxido Dismutasa , Extractos Vegetales/farmacología , Superóxido Dismutasa-1RESUMEN
LiNiO2 cathode material for lithium-ion batteries has the advantages of high specific capacity, abundant resources, and low cost, but it suffers from difficulties in preparation, structural instability, and serious capacity decay. In this work, highly pure and layered structural LiNi0.95 Ala Ti0.05-a O2 (a=0, 0.025, 0.05) cathode materials were synthesized by a simply sol-gel method. The cation mixing of Ni2+ and Li+ , structural deterioration, irreversible conversion between H2 and H3 phases and unstable surface and CEI (Cathode-electrolyte interface) film can be effectively suppressed by co-doping with Al3+ and Ti4+ . A preferred LiNi0.95 Al0.025 Ti0.025 O2 sample provides a discharge specific capacity of 223â mAh g-1 at 0.1â C and 148.32â mAh g-1 at 5â C, a capacity retention of 72.7 % after 300â cycles at 1â C and a Li+ diffusion coefficient of about 2.0×10-9 cm2 s-1 .