In vitro efficacy of Duddingtonia flagrans against nematodes of sheep based on in vivo calculations / Eficácia in vitro de Duddingtonia flagrans contra nematoides de ovinos com base em cálculo in vivo

Duddingtonia flagrans has been tested as an alternative parasite control, but data from in vitro experiments based on in vivo calculations describing nematophagous fungi predation in nematodes are restricted. The objective of this work was to determine the efficacy of D. flagrans against sheep nematode larvae in vitro using in vivo calculations. Fecal samples were introduced to fungi in different concentrations: 0.0/control; 0.05; 0.1; 0.2; 0.4; 0.8; 1.6; 3.2; and 6.4 g corresponding, respectively, to 583.000; 1.166.000; 2.332.000; 4.664.000; 9.328.000; 18.656.000; 37.312.000 and 74.624.000 chlamydospores/kg of body weight. The material was incubated for 14 days, before the larvae recovery (Assay 1). Assay 2 was carried out with the doses of 0.00625; 0.0125; and 0.025 g. The results showed a negative correlation between fungal concentrations and larval numbers for both assays. The fungus demonstrated an efficacy above 89% in both assays. Thus, we consider that the data from in vitro studies based on in vivo calculations may optimize the fungi quantities for field experiments.(AU)

Duddingtonia flagrans tem sido testado como uma alternativa no controle de parasitos, entretanto, trabalhos in vitro da predação de nematoides por fungos nematófagos correlacionados com cálculos baseados para testes in vivo são restritos. O objetivo deste trabalho foi determinar a eficácia in vitro de D. flagrans contra larvas de nematoides de ovinos tendo como base cálculos in vivo. Amostras fecais receberam a adição do fungo em diferentes concentrações: 0.0/controle; 0,05; 0,1; 0,2; 0,4; 0,8; 1,6; 3,2 e 6,4 gramas correspondendo, respectivamente, às seguintes dosagens: 583.000; 1.166.000; 2.332.000; 4.664.000; 9.328.000; 18.656.000; 37.312.000 e 74.624.000 clamidósporos/Kg de peso vivo animal. O material foi incubado por 14 dias, para recuperação das larvas (Ensaio 1). O Ensaio 2 foi realizado com concentrações de 0,00625; 0,0125 e 0,025 g. Foi observada correlação negativa entre a concentração fúngica e o número de larvas, nos dois ensaios. O fungo demonstrou eficácia acima de 89% em ambos os ensaios. A partir destes dados, acreditamos que ensaios in vitro baseados em cálculos in vivo podem aprimorar as dosagens para a realização de experimentos a campo.(AU)

Glicemia de gatos obesos obtida por meio do teste de tolerância à glicose / Glucose of obese cats obtained through the glucose tolerance test

Esse trabalho avaliou a glicemia de gatos obesos por meio do teste de tolerância à glicose, a fim de identificar a hiperglicemia por resistência à insulina nesses animais. Foram avaliados 16 gatos, sendo oito com condição corpórea ideal (Grupo Controle) e oito com sobrepeso (Grupo Sobrepeso).  Após jejum alimentar de 12 horas, os animais receberam glicose, via intravenosa, na dose de 0,5g/kg e amostras de sangue foram coletadas para aferição da glicemia no Tempo zero, após 10 (Tempo 1), 30 (Tempo 2), 60 (Tempo 3), 90 (Tempo 4) e 120 (Tempo 5) minutos. No teste de tolerância à glicose, não houve diferença significativa na comparação da glicemia entre os tempos dos dois grupos. Na comparação entre os tempos de um mesmo grupo pode-se verificar que diferentemente do Grupo Controle, não houve diferença significativa entre os Tempo 1 e Tempo 2 do Grupo Sobrepeso, sugerindo um discreto retardo na redução da concentração de glicose entre esses tempos. No estudo realizado, o teste de tolerância à glicose intravenosa apresentou-se factível, porém o período mínimo de 2 anos de obesidade foi insuficiente para a observação de alterações significativas no metabolismo da glicose em gatos obesos. Entretanto, foi possível observar o retardo na redução da concentração de glicose entre 10 e 30 minutos, o que pode estar relacionado à resistência à insulina.(AU)

This study evaluated by glucose tolerance test, the blood glucose of 16 cats, eight with ideal body condition (Control Group)and eight overweight cats (Overweight Group), aiming at the insulin resistance hyperglycemia identification in obese cats.After 12 hour feedings, the animals were given intravenous glucose at a dose of 0.5 g / kg and blood samples were collected forthe measurement of glycemia at time zero after 10 (Time 1), 30 (Time 2), 60 (Time 3), 90 (Time 4) and 120 (Time 5) minutes. In theglucose tolerance test, there was no significant difference in the glycemia comparison between the times of the two groups. Theanalysis between the times of same group, it was possible to notice that unlike Control Group, there was no significant differencebetween Time 1 and Time 2 of the Overweight Group, suggesting a slight delay in the glucose concentration decrease betweenthese times, indicating a possible tendency to insulin resistance. In the study, the intravenous glucose tolerance test presented befeasible, but the minimum period of two years of obesity was insufficient for observing significant changes in glucose metabolismin obese cats. However, it was possible to observe the delay in the reduction of glucose concentration between 10 and 30 minutes,which may be related to insulin resistance.(AU)

Metazoan fauna parasitizing Peckoltia braueri and Pterygoplichthys pardalis (Loricariidae) catfishes from the northeastern Brazilian Amazon / Fauna de metazoários parasitando Peckoltia braueri e Pterygoplichthys pardalis (Loricariidae), bagres do nordeste da Amazônia brasileira

This study investigated the metazoan parasite fauna in Peckoltia braueri and Pterygoplichthys pardalis from a tributary of the Amazon River system, in northern Brazil. In P. braueri, 630 parasites were collected, belonging to Unilatus unilatus, Nothogyrodactylus sp., Genarchella genarchella, Proteocephalus sp., Gorytocephalus elongorchis, Dolops longicauda and Hirudinea gen. sp., with a dominance of monogenean species. In P. pardalis, 120 parasites were collected, belonging to U. unilatus, Acanthostomum gnerii and Gorytocephalus elongorchis, and this acanthocephalan was the dominant species. In both hosts, the parasites presented clumped distribution, high prevalence, low abundance, low Shannon diversity, and low species richness, with a predominance of helminth species. In P. braueri, host length was positively correlated with parasite species richness and Shannon index. There was no difference in the body condition of parasitized and non-parasitized fishes in either host. This was the first report of these parasites in P. braueri and P. pardalis.(AU)

Este estudo investigou a fauna de parasitos metazoários em Peckoltia braueri e Pterygoplichthys pardalis de um tributário do sistema do Rio Amazonas, no Amapá, norte do Brasil. Em P. braueri foram coletados 630 parasitos das espécies Unilatus unilatus, Nothogyrodactylus sp., Genarchella genarchella, Proteocephalus sp., Gorytocephalus elongorchis, Dolops longicauda e Hirudinea gen. sp., com dominância das espécies de monogenoideas. Em P. pardalis foram coletados 120 parasitos das espécies U. unilatus, Acanthostomum gnerii e Gorytocephalus elongorchis, sendo este acantocéfalo a espécie dominante. Os parasitos em ambos hospedeiros apresentaram dispersão agregada, elevada prevalência, baixa abundância, baixa diversidade de Shannon e baixa riqueza de espécies, com predominância de espécies de helmintos. Em P. braueri, o comprimento dos hospedeiros apresentou correlação positiva com a riqueza de espécies de parasitos e o índice de Shannon. Não houve diferença entre a condição corporal de peixes parasitados e não parasitados para os dois hospedeiros. Este foi o primeiro relato desses parasitos para P. braueri e P. pardalis.(AU)

Two new species of Myotis (Chiroptera: Vespertilionidae) for Argentina

Seven new species of Myotis have been recently described from South America, elevating to 20 the total number of species of the genus recognized for the region. Myotis izecksohni and Myotis lavali were recently described from the States of Rio de Janeiro, Paraná and Pernambuco, Brazil. These are clearly different from all other known species of the genus in their external and cranial characters, which are exactly comparable with our specimens collected in Argentina. This allows to greatly expand the known geographic distributions for these two species. The addition to Argentina of Myotis lavali with specimens collected in the Yungas ecoregion of Salta Province, and Myotis izecksohni with specimens collected in the Fields and Weedlands ecoregion of Misiones Province, increases the known ecoregions to date for the distribution of the two species.

Siete nuevas especies de Myotis han sido recientemente descriptas en Sud América elevando a 20 el número de especies del género conocidas para la región. Myotis izecksohni y Myotis lavali han sido descriptas recientemente mediante ejemplares procedentes de los Estados de Río de Janeiro, Paraná y Pernambuco, Brasil. Estas especies son claramente diferentes de todas las otras conocidas del género, tanto en sus características externas como craneales, dichos caracteres coinciden exactamente con los de ejemplares encontrados en Argentina. Estos hallazgos permiten extender significativamente la extensión distribucional de las dos especies, e incluir a Myotis lavali en la eco-región de las Yungas en la provincia de Salta, y a Myotis izecksohni en la eco-región de los Campos y Malezales de la provincia de Misiones. Dichas eco-regiones no eran conocidas para la distribución de las nuevas especies.

In vitro efficacy of Duddingtonia flagrans against nematodes of sheep based on in vivo calculations

Abstract Duddingtonia flagrans has been tested as an alternative parasite control, but data from in vitro experiments based on in vivo calculations describing nematophagous fungi predation in nematodes are restricted. The objective of this work was to determine the efficacy of D. flagrans against sheep nematode larvae in vitro using in vivo calculations. Fecal samples were introduced to fungi in different concentrations: 0.0/control; 0.05; 0.1; 0.2; 0.4; 0.8; 1.6; 3.2; and 6.4 g corresponding, respectively, to 583.000; 1.166.000; 2.332.000; 4.664.000; 9.328.000; 18.656.000; 37.312.000 and 74.624.000 chlamydospores/kg of body weight. The material was incubated for 14 days, before the larvae recovery (Assay 1). Assay 2 was carried out with the doses of 0.00625; 0.0125; and 0.025 g. The results showed a negative correlation between fungal concentrations and larval numbers for both assays. The fungus demonstrated an efficacy above 89% in both assays. Thus, we consider that the data from in vitro studies based on in vivo calculations may optimize the fungi quantities for field experiments.

Resumo Duddingtonia flagrans tem sido testado como uma alternativa no controle de parasitos, entretanto, trabalhos in vitro da predação de nematoides por fungos nematófagos correlacionados com cálculos baseados para testes in vivo são restritos. O objetivo deste trabalho foi determinar a eficácia in vitro de D. flagrans contra larvas de nematoides de ovinos tendo como base cálculos in vivo. Amostras fecais receberam a adição do fungo em diferentes concentrações: 0.0/controle; 0,05; 0,1; 0,2; 0,4; 0,8; 1,6; 3,2 e 6,4 gramas correspondendo, respectivamente, às seguintes dosagens: 583.000; 1.166.000; 2.332.000; 4.664.000; 9.328.000; 18.656.000; 37.312.000 e 74.624.000 clamidósporos/Kg de peso vivo animal. O material foi incubado por 14 dias, para recuperação das larvas (Ensaio 1). O Ensaio 2 foi realizado com concentrações de 0,00625; 0,0125 e 0,025 g. Foi observada correlação negativa entre a concentração fúngica e o número de larvas, nos dois ensaios. O fungo demonstrou eficácia acima de 89% em ambos os ensaios. A partir destes dados, acreditamos que ensaios in vitro baseados em cálculos in vivo podem aprimorar as dosagens para a realização de experimentos a campo.

In vitro efficacy of Duddingtonia flagrans against nematodes of sheep based on in vivo calculations

Abstract Duddingtonia flagrans has been tested as an alternative parasite control, but data from in vitro experiments based on in vivo calculations describing nematophagous fungi predation in nematodes are restricted. The objective of this work was to determine the efficacy of D. flagrans against sheep nematode larvae in vitro using in vivo calculations. Fecal samples were introduced to fungi in different concentrations: 0.0/control; 0.05; 0.1; 0.2; 0.4; 0.8; 1.6; 3.2; and 6.4 g corresponding, respectively, to 583.000; 1.166.000; 2.332.000; 4.664.000; 9.328.000; 18.656.000; 37.312.000 and 74.624.000 chlamydospores/kg of body weight. The material was incubated for 14 days, before the larvae recovery (Assay 1). Assay 2 was carried out with the doses of 0.00625; 0.0125; and 0.025 g. The results showed a negative correlation between fungal concentrations and larval numbers for both assays. The fungus demonstrated an efficacy above 89% in both assays. Thus, we consider that the data from in vitro studies based on in vivo calculations may optimize the fungi quantities for field experiments.

Resumo Duddingtonia flagrans tem sido testado como uma alternativa no controle de parasitos, entretanto, trabalhos in vitro da predação de nematoides por fungos nematófagos correlacionados com cálculos baseados para testes in vivo são restritos. O objetivo deste trabalho foi determinar a eficácia in vitro de D. flagrans contra larvas de nematoides de ovinos tendo como base cálculos in vivo. Amostras fecais receberam a adição do fungo em diferentes concentrações: 0.0/controle; 0,05; 0,1; 0,2; 0,4; 0,8; 1,6; 3,2 e 6,4 gramas correspondendo, respectivamente, às seguintes dosagens: 583.000; 1.166.000; 2.332.000; 4.664.000; 9.328.000; 18.656.000; 37.312.000 e 74.624.000 clamidósporos/Kg de peso vivo animal. O material foi incubado por 14 dias, para recuperação das larvas (Ensaio 1). O Ensaio 2 foi realizado com concentrações de 0,00625; 0,0125 e 0,025 g. Foi observada correlação negativa entre a concentração fúngica e o número de larvas, nos dois ensaios. O fungo demonstrou eficácia acima de 89% em ambos os ensaios. A partir destes dados, acreditamos que ensaios in vitro baseados em cálculos in vivo podem aprimorar as dosagens para a realização de experimentos a campo.

Two new species of Myotis (Chiroptera: Vespertilionidae) for Argentina

Seven new species of Myotis have been recently described from South America, elevating to 20 the total number of species of the genus recognized for the region. Myotis izecksohni and Myotis lavali were recently described from the States of Rio de Janeiro, Paraná and Pernambuco, Brazil. These are clearly different from all other known species of the genus in their external and cranial characters, which are exactly comparable with our specimens collected in Argentina. This allows to greatly expand the known geographic distributions for these two species. The addition to Argentina of Myotis lavali with specimens collected in the Yungas ecoregion of Salta Province, and Myotis izecksohni with specimens collected in the Fields and Weedlands ecoregion of Misiones Province, increases the known ecoregions to date for the distribution of the two species.(AU)

Siete nuevas especies de Myotis han sido recientemente descriptas en Sud América elevando a 20 el número de especies del género conocidas para la región. Myotis izecksohni y Myotis lavali han sido descriptas recientemente mediante ejemplares procedentes de los Estados de Río de Janeiro, Paraná y Pernambuco, Brasil. Estas especies son claramente diferentes de todas las otras conocidas del género, tanto en sus características externas como craneales, dichos caracteres coinciden exactamente con los de ejemplares encontrados en Argentina. Estos hallazgos permiten extender significativamente la extensión distribucional de las dos especies, e incluir a Myotis lavali en la eco-región de las Yungas en la provincia de Salta, y a Myotis izecksohni en la eco-región de los Campos y Malezales de la provincia de Misiones. Dichas eco-regiones no eran conocidas para la distribución de las nuevas especies.(AU)

Ausência de Helicobacter spp. em lesões gástricas de suínos pelo método Warthin-Starry / Absence of Helicobacter spp. in gastric lesions in pigs using Warthin-Starry staining method / Ausencia de Helicobacter spp. en lesiones gástricas en cerdos utilizando el método de tinción de Warthin -Starry

Ao considerar o impacto das úlceras gástricas na saúde animal, as perdas econômicas que podem ser geradas por elas, a falta de dados sobre a etiologia do processo e a possibilidade de estabelecer ações preventivas, objetivou-se com este estudo verificar lesões gástricas em suínos em idade de abate e relacionar os resultados com infecção por Helicobacter spp. Foram analisados estômagos suínos que apresentaram lesões em região de pars esophagea. A coleta foi realizada no matadouro frigorífico de Muniz Freire, Espírito Santo, sob Serviço de Inspeção Estadual. Ao verificar a existência de lesões gástricas, o órgão era avaliado e classificado macroscopicamente. Após, quatro fragmentos de cada estômago foram coletados: região de pars esophagea; região de corpo; região de fundo e região pilórica. O material obtido foi encaminhado ao Setor de Patologia Animal da Universidade Federal do Espírito Santo, onde foi submetido ao processamento de rotina para inclusão em parafina e microtomia. Para cada bloco de parafina foram confeccionadas duas lâminas, sendo uma corada pelo método Hematoxilina-Eosina e outra corada pelo método Warthin-Starry. As lâminas foram classificadas conforme as lesões microscópicas e avaliadas para presença de bactérias do gênero Helicobacter. Após obtenção dos dados, os resultados foram submetidos à análise descritiva. Todos os estômagos apresentavam algum grau de lesão. Apenas um estômago não apresentou lesão na porção glandular. Ao analisar a lesão microscópica de paraqueratose, verificou-se presença dessa alteração na porção aglandular de oito estômagos. Não houve paraqueratose em nenhuma região glandular. Quatro estômagos apresentaram ulceração na microscopia. Todos os estômagos apresentaram algum grau de infiltrado inflamatório mononuclear. Em nenhuma amostra foi possível visualizar bacilos do gênero Helicobacter.[...]

Considering the impact of the gastric ulcers in animal health, the economic losses created by them, the lack of information about its etiology and the possibility to establish preventive actions, the aim of this study was to verify gastric lesions in pigs at slaughter age and to relate the results with Helicobacter spp. infection. The stomachs of pigs with lesions in pars esophageal region were analyzed. The collect was performed at an abattoir located in Muniz Freire, Espírito Santo, under State Inspection Service. When noted the presence of gastric lesion, the organ was analyzed and classified macroscopically. After that, four fragments of each stomach were collected: pars esophageal region, corpus region, fundic region and pyloric region. This material was sent to the Animal Pathology Department of Federal University of Espírito Santo [Universidade Federal do Espírito Santo] where it underwent routine histological processing for paraffin embedding and microtomy. For each paraffin block two histological slides were made, one was stained using the hematoxylin-eosin (HE) staining method and the other was stained using Warthin-Starry staining method. The histological slides were classified according to microscopic lesions and analyzed for presence of bacteria from the genus Helicobacter. After obtaining these information, the results underwent statistical analysis using descriptive research. All the stomachs had some degree of lesion. Only one stomach did not presented lesion in the glandular region. The microscopic analysis of the non-glandular region revealed parakeratosis in eight stomachs. There was no parakeratosis in the glandular region. Four stomachs presented ulceration during microscopic analyses. All stomachs had some degree of mononuclear inflammation. It was not possible to find bacillus of the genus Helicobacter in any of the samples.[...]

Al considerar el impacto de las úlceras gástricas en la sanidad animal, las pérdidas económicas que se pueden generar para ellos, la falta de datos sobre la etiología del proceso y la posibilidad de establecer acciones de prevención dirigido a verificar este estudio en las lesiones gástricas en cerdos en edad masacre y se relacionan los resultados con la infección por Helicobacter spp. Se analizaron los estómagos de cerdos con lesiones en la región de pars esophagea. La recolección de datos se llevó a cabo en el matadero frigorífico Muniz Freire, Espírito Santo, bajo Servicio de Inspección del Estado. Para comprobar si hay lesiones gástricas, el órgano fue evaluado y clasificado macroscópicamente. Después de cuatro fragmentos de cada estómago se recogieron: la región de pars esophagea; región del cuerpo; región de fondo y la región pilórica. El material fue enviado a la División de Patología Animal de la Universidad Federal de Espírito Santo [Universidade Federal do Espírito Santo], donde fue sometido al tratamiento de rutina para inclusión en parafina y microtomía. Para cada bloque de parafina se realizaron dos clavijas, una teñidas con hematoxilina-eosina y otra teñida por el método de Warthin-Starry. Los portaobjetos se clasifican como lesiones microscópicas y se evaluaron para la presencia de bacterias Helicobacter género. Una vez obtenidos los datos, los resultados fueron sometidos a análisis descriptivo. Todos los estómagos con algún grado de lesión. Sólo un estómago no mostró lesiones porción glandular. Analizar la paraqueratosis lesión microscópica, hubo alteración en la porción aglandular ocho estómagos. No hubo paraqueratosis en cualquier glandular. Cuatro estómagos mostraron microscopía ulceración. Todos los estómagos tenían algún grado de infiltración de células mononucleares. En cualquier muestra puede ver Helicobacter género Bacillus.[...]

Antiproliferative and genotoxic effects of nature identical and artificial synthetic food additives of aroma and flavor / Efeito antiproliferativo e genotóxico de aditivos alimentares de aroma e sabor sintéticos, dos tipos idêntico ao natural e artificial

This study aimed to analyze the antiproliferative and genotoxic potential of synthetic food flavorings, nature identical passion fruit and artificial vanilla. This assessment used root meristem cells of Allium cepa L., in exposure times of 24 and 48 hours and using doses of 0.2; 0.4 and 0.6 mL. Roots were fixed in Carnoys solution, hydrolyzed in hydrochloric acid, stained with acetic orcein and analyzed with optical microscope at 400× magnification, 5,000 cells for each treatment. For data analysis, it was used Chi-square test at 5%. Doses of 0.2 mL at ET 48 h; 0.4 and 0.6 mL at ET 24 and 48 h of passion fruit flavor, and the three doses of the vanilla flavor at ET 24 and 48 h significantly reduced the cell division rate in the meristems of roots, proving to be cytotoxic. Doses of 0.2; 0.4 and 0.6 mL of the passion fruit additive, and the three doses of vanilla tested, in the two exposure times, induced mitotic spindle changes and micronuclei formation in the cells of the test organism used, proving to be genotoxic. Therefore, under the studied conditions, flavoring solutions of vanilla and passion fruit, marketed nationally and internationally, significantly altered the functioning of the cell cycle in root meristem cells of A. cepa.(AU)

Neste trabalho teve-se por objetivo analisar o potencial antiproliferativo e genotóxico de aromatizantes alimentares sintéticos, idêntico ao natural de Maracujá, e artificial de Baunilha. Esta avaliação foi realizada por meio das células meristemáticas de raízes de Allium cepa L., nos tempos de exposição de 24 e 48 horas e nas doses de 0,2; 0,4 e 0,6 ml. As raízes foram fixadas em solução de Carnoy, hidrolisadas em ácido clorídrico e coradas com orceína acética. Analisou-se, em microscópio óptico em aumento de 400×, 5.000 células por grupo tratamento, e utilizou-se o teste estatístico Qui-quadrado a 5% para análise dos dados. Verificou-se que as doses de 0,2 ml, no TE 48 h; 0,4 e 0,6 ml, nos TE 24 e 48 h, do aromatizante de Maracujá, e as três doses analisadas, nos TE 24 e 48 h, do aditivo de Baunilha reduziram significativamente o índice de divisão celular dos meristemas de raízes, mostrando-se citotóxicas. As doses 0,2; 0,4 e 0,6 ml do aditivo de Maracujá, e a de 0,6 ml do aromatizante de Baunilha, nos dois tempos de exposição considerados, induziram alterações de fuso mitótico e micronúcleos as células do organismo de prova utilizado, mostrando-se genotóxicas. Portanto, nas condições analisadas, as soluções aromatizantes de Baunilha e Maracujá, comercializadas nacional e internacionalmente, alteraram significativamente o funcionamento do ciclo celular das células meristemáticas de raízes de A. cepa.(AU)

Dynamics and role of MicroRNAs during mammalian follicular development

Ovarian functions, which involve dynamically regulated processes of selection, recruitment and dominance, are known to be regulated by an array of genes, which are expressed in spatiotemporal manner in follicular somatic cells and gametes. This differential expression of genes in mammalian follicular cells is partly regulated by posttranscriptional gene regulators named microRNAs (miRNAs). In addition to the cellular miRNAs, growing number of evidences are available on the potential role of extracellular vesicles mediated transfer of miRNAs in follicular fluid. These extracellular vesicles are shown to be involved in cellto-cell communication within the follicular environment. The molecular messages carried by the extracellular vesicles released into extracellular space are thought to be reflections of the physiological status of the cells from where they are released. Therefore due to their structural nature and potential to cargo several physiologically relevant molecules, exosomes have a great potential to be used as markers of oocyte developmental competence in follicular environment. Here, we review large sets of literatures to show the dynamic nature of miRNAs during various stages of mammalian follicular development, oocyte growth and the role of some of the miRNAs in ovarian cell functions. Moreover, the presence of microvesicle and exosome-coupled extracellular miRNAs in mammalian follicular fluid and their potential involvement in cellto-cell communication are briefly discussed.

Dynamics and role of MicroRNAs during mammalian follicular development

Ovarian functions, which involve dynamically regulated processes of selection, recruitment and dominance, are known to be regulated by an array of genes, which are expressed in spatiotemporal manner in follicular somatic cells and gametes. This differential expression of genes in mammalian follicular cells is partly regulated by posttranscriptional gene regulators named microRNAs (miRNAs). In addition to the cellular miRNAs, growing number of evidences are available on the potential role of extracellular vesicles mediated transfer of miRNAs in follicular fluid. These extracellular vesicles are shown to be involved in cellto-cell communication within the follicular environment. The molecular messages carried by the extracellular vesicles released into extracellular space are thought to be reflections of the physiological status of the cells from where they are released. Therefore due to their structural nature and potential to cargo several physiologically relevant molecules, exosomes have a great potential to be used as markers of oocyte developmental competence in follicular environment. Here, we review large sets of literatures to show the dynamic nature of miRNAs during various stages of mammalian follicular development, oocyte growth and the role of some of the miRNAs in ovarian cell functions. Moreover, the presence of microvesicle and exosome-coupled extracellular miRNAs in mammalian follicular fluid and their potential involvement in cellto-cell communication are briefly discussed.(AU)

Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis

Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 g/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 g/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 g/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.(AU)

Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis

Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 g/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 g/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 g/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.

Pontes de miocárdio em corações de suínos (SUS domesticus) e suas possíveis influências sobre lesões ateroscleróticas em artérias coronárias / Myocardial bridge of pigs (Sus domesticus) hearts associated with lesions of coronary arteries

Seek, therefore, to analyze in adults and young pigs, under light microscopy, the morphological characteristics of the coronary arterial branches under of the myocardial bridges, as well as the prepontine and postpontine segments, attempting to establish morphofunctional correlations between these. Was used for the study 40 pig hearts, all mongrel females, being 20 young and 20 adults, all with myocardial bridges, of which were removed prepontine, pontine and postpontine segments of the coronary arteries, together with the surrounding tissue. The segments were submitted with usual techniques of the light microscopy and stained with hematoxylin and eosin. Changes were observed in tunica intima, such as thickening, cells with clear cytoplasm, disruption and duplication of the limiting internal elastic lamina. The statistical test was significant for the position in adult pigs, confirming that there is a highter frequency of lesions in prepontine segment of the tunica intima of the coronary arteries when compared with the pontine and postpontine segments. The statistical test confirmed variation in the lesions frequency between sample studied, being highter in young animals when compared with adult animals. For the young animals, the test was not significant for the variable positions between of the segments compared with each other. There is statistically a highter occurrence of atherosclerotic lesions which precedes the myocardial bridge in relation to the others segments studied.

Buscou-se analisar em suínos jovens e adultos, sob microscopia de luz, as características morfológicas dos ramos arteriais coronarianos sob as pontes de miocárdio, bem como dos segmentos pré-pontino e pós-pontino, na tentativa de estabelecer correlações morfofuncionais entre eles. Foram utilizados 40 corações de suínos para a pesquisa, todos fêmeas sem raça definida, sendo 20 jovens e 20 adultos, todos portadores de pontes de miocárdio, dos quais foram retirados fragmentos pré-pontino, pontino e pós-pontino de ramos da artéria coronária direita e esquerda, junto com o tecido circunjacente. Os segmentos foram submetidos às técnicas habituais da microscopia de luz e corados pela hematoxilina-eosina. Observou-se alterações da íntima, tais como espessamentos, células com citoplasma claro, ruptura e/ou duplicação da lâmina limitante elástica interna. O teste estatístico se mostrou significativo para posição em suínos adultos, confirmando que existe uma maior frequência de lesões no segmento pré-pontino da túnica íntima das artérias coronárias quando comparado com o segmento pontino e com o pós-pontino. O mesmo teste confirmou uma variação na frequência de lesões entre as amostras estudadas, sendo maior em animais jovens quando defrontado com animais adultos. Paraos animais jovens, o teste não se apresentou significativo para a variável posição entre nenhum dos segmentos comparados entre si. Concluiu-se, estatisticamente, uma maior ocorrência de lesões ateroscleróticas nos segmentos arteriais que antecedem a ponte de miocárdio em relação aos demais segmentos estudados.

Pontes de miocárdio em corações de suínos (SUS domesticus) e suas possíveis influências sobre lesões ateroscleróticas em artérias coronárias / Myocardial bridge of pigs (Sus domesticus) hearts associated with lesions of coronary arteries

Seek, therefore, to analyze in adults and young pigs, under light microscopy, the morphological characteristics of the coronary arterial branches under of the myocardial bridges, as well as the prepontine and postpontine segments, attempting to establish morphofunctional correlations between these. Was used for the study 40 pig hearts, all mongrel females, being 20 young and 20 adults, all with myocardial bridges, of which were removed prepontine, pontine and postpontine segments of the coronary arteries, together with the surrounding tissue. The segments were submitted with usual techniques of the light microscopy and stained with hematoxylin and eosin. Changes were observed in tunica intima, such as thickening, cells with clear cytoplasm, disruption and duplication of the limiting internal elastic lamina. The statistical test was significant for the position in adult pigs, confirming that there is a highter frequency of lesions in prepontine segment of the tunica intima of the coronary arteries when compared with the pontine and postpontine segments. The statistical test confirmed variation in the lesions frequency between sample studied, being highter in young animals when compared with adult animals. For the young animals, the test was not significant for the variable positions between of the segments compared with each other. There is statistically a highter occurrence of atherosclerotic lesions which precedes the myocardial bridge in relation to the others segments studied. (AU)

Buscou-se analisar em suínos jovens e adultos, sob microscopia de luz, as características morfológicas dos ramos arteriais coronarianos sob as pontes de miocárdio, bem como dos segmentos pré-pontino e pós-pontino, na tentativa de estabelecer correlações morfofuncionais entre eles. Foram utilizados 40 corações de suínos para a pesquisa, todos fêmeas sem raça definida, sendo 20 jovens e 20 adultos, todos portadores de pontes de miocárdio, dos quais foram retirados fragmentos pré-pontino, pontino e pós-pontino de ramos da artéria coronária direita e esquerda, junto com o tecido circunjacente. Os segmentos foram submetidos às técnicas habituais da microscopia de luz e corados pela hematoxilina-eosina. Observou-se alterações da íntima, tais como espessamentos, células com citoplasma claro, ruptura e/ou duplicação da lâmina limitante elástica interna. O teste estatístico se mostrou significativo para posição em suínos adultos, confirmando que existe uma maior frequência de lesões no segmento pré-pontino da túnica íntima das artérias coronárias quando comparado com o segmento pontino e com o pós-pontino. O mesmo teste confirmou uma variação na frequência de lesões entre as amostras estudadas, sendo maior em animais jovens quando defrontado com animais adultos. Paraos animais jovens, o teste não se apresentou significativo para a variável posição entre nenhum dos segmentos comparados entre si. Concluiu-se, estatisticamente, uma maior ocorrência de lesões ateroscleróticas nos segmentos arteriais que antecedem a ponte de miocárdio em relação aos demais segmentos estudados.(AU)

Síndrome metabólico: relación entre obesidad, resistencia a la insulina e hipertensión sistemica en pequeños animales / Metabolic syndrome: relationship between obesity, insulin resistance and systemic hypertension in small animals / Síndrome metabólica: relação entre obesidade, resistência insulínica e hipertensão arterial sistêmica nos pequenos animais

La presente revisión objetiva definir el síndrome metabólico y la acción del tejido adiposo sobre la resistencia a la insulina e hipertensión arterial sistémica en pequeños animales (Perros y gatos). El síndrome metabólico, típico en individuos obesos, es considerado un conjunto de factores de riesgo, que los predispone al desarrollo de resistencia a la insulina e hipertensión arterial, que puede llevar a cuadros endocrinos, como diabetes mellitus tipo 2 y enfermedades cardiovasculares. Este se caracteriza por obesidad, hipertrigliceridemia, hipercolesteronemia, hipertensión arterial sistémica y un ligero aumento de la glicemia sérica en ayuno. Se sabe que el tejido adiposo funciona como un importante órgano endocrino, secretando factores que ayudan al aumento de la glicemia, disminución de la acción de la insulina y aumento de la presión arterial en el organismo. El tratamiento del síndrome principalmente es basado en actividad física y la dieta. A pesar de ser diagnosticada frecuentemente en medicina, todavía hay dudas en medicina veterinaria sobre su existencia y mecanismos fisiopatológicos, de este modo se deben realizar más estudios en el área.

The present review aims to define the metabolic syndrome and the action of fat on insulin resistance and hypertension in small animals (dogs and cats). Metabolic syndrome is considered a set of risk factors that predispose individuals to the development of insulin resistance and hypertension, which can lead to endocrine disease, as diabetes mellitus type 2 and cardiovascular disease. It consists of obesity, hypertriglyceridemia, hypercholesterolemia, hypertension and slight increase or in the upper limit of fasting serum glucose. The adipose tissue functions as an important endocrine organ, secreting factors that contribute to increased blood glucose levels, decreased insulin action and increased blood pressure in the body. Treatment of the syndrome is mainly based on physical activity and dieting. Although it is often diagnosed in Medicine, there are still doubts about its existence and pathophysiological mechanisms in Veterinary Medicine, so further studies should be conducted in the area.

A presente revisão objetiva definir a síndrome metabólica e a ação do tecido adiposo sobre à resistência insulínica e hipertensão arterial sistêmica em pequenos animais (cães e gatos). A síndrome metabólica, típica de indivíduos obesos, é considerada um conjunto de fatores de risco que predispõe ao desenvolvimento de resistência à insulina e hipertensão arterial, podendo levar a quadros endócrinos, como diabetes mellitus tipo 2 e doenças cardiovasculares. É caracterizada por obesidade central, hipertrigliceridemia, hipercolesterolemia, hipertensão arterial sistêmica e aumento discreto ou no limite superior da glicemia sérica em jejum. O tecido adiposo funciona como um importante órgão endócrino, secretando fatores que contribuem para o aumento da glicemia, diminuição da ação da insulina e aumento da pressão arterial no organismo. O tratamento da síndrome baseia-se principalmente na prática de atividade física e dieta. Apesar de ser frequentemente diagnosticada na medicina, ainda há dúvidas sobre sua existência e mecanismos fisiopatológicos na Medicina Veterinária, portanto mais estudos na área devem ser realizados.

The presence of Microlobius foetidus cause changes in the antioxidant defense of Urochloa decumbens? / A presença de Microlobius foetidus causa alteraçõess na defesa antioxidante de Urochloa decumbens?

Urochloa decumbens (Stapf) R. D. Webster (Poaceae) is an exotic species with has spread rapidly through the Cerrado area of Pantanal, Mato Grosso do Sul, Brazil. It has covered the soil aggressively turning it into cultivated pastures. Thus, it has become a challenge to protect native areas due its capacity of exclusion of native species. It has been observed that Microlobius foetidus (Jacq.) M.Sousa & G.Andrade species (Fabaceae) shows a dominant pattern over the development of U. decumbens. This work shows that M. foetidusinterfere on the natural growth of U. decumbens within 10 m ratio. Between 15 and 20 m, it was observed an increase of Importance Value index (IVI) and Relative cover (RC) values. It was also observed a variation on the antioxidant defense system of U. decumbens within 10m ratio from M. foetidus. The enzymes superoxide dismutase, catalase and peroxidase present higher levels of activity then those found for glutathione reductase. This data indicates that M. foetidus may have an effect on U. decumbens, increase the activity of antioxidant enzymes. This effect probably happens as means to neutralize the toxic effects of the oxygen generated due to the presence of allelochemicals, which increases oxidative stress.(AU)

Urochloa decumbens (Stapf) R. D. Webster (Poaceae) é uma espécie exótica que se expandiu rapidamente no Cerrado do Pantanal de Mato Grosso do sul, e cobre o solo de maneira agressiva convertendo a vegetação natural em pastagens cultivadas e se tornando um desafio para o controle em áreas protegidas devido a sua capacidade de excluir espécies nativas. Observações demonstraram que a espécie Microlobius foetidus(Jacq.) M.Sousa & G.Andrade (Fabaceae) apresenta padrões de dominância, interferindo no desenvolvimento de U. decumbens e alterações na fitofisionomia e sistema de defesa antioxidante desta espécie foram investigados. Nossos estudos demonstraram que M. foetidus interfere no crescimento de U. decumbens nos primeiros 10 metros de distância, sendo que aos 15 e 20 metros, é verificado um aumento nos valores de IVI e CR. Alterações no sistema de defesa antioxidante de U. decumbens também foram verificados nos indivíduos amostrados até 10 metros de distância. Superóxido dismutase, catalase e peroxidase foram provavelmente as enzimas cruciais envolvidas na neutralização de espécies reativas de oxigênio, uma vez que apresentaram maiores níveis de atividade em comparação com outras enzimas, tais como glutationa redutase. Os dados indicam que a proximidade de U. decumbens as áreas onde se encontram populações de M. foetidus, aumentam a atividade das enzimas antioxidantes. Este efeito provavelmente ocorre como meio para neutralizar os efeitos tóxicos do oxigênio gerado, devido à presença de aleloquímicos, o que aumenta o estresse oxidativo.(AU)

Semen processing and artificial insemination in goats and sheep / Tecnologia de sêmen e inseminação artificial em caprinos e ovinos

Artificial insemination (AI) is the oldest and most widely used assisted reproductive technique applied in livestock production. Associated with preservation of sperm, artificial insemination, offers many advantages to farmers, since it allows accelerating the genetic improvement of the herd, control sexually transmitted diseases, as well as preserve of the genetic material of endangered breeds. However, in small ruminants this technique is little used compared to other species. This is due to, in part, to the fertility results irregular and generally low obtained with the use of frozen semen. This paper discusses briefly the main technology currently used in the semen processing and AI in small ruminants and their success rates.

A inseminação artificial (IA) é a técnica de reprodução assistida, mais antiga e mais utilizada na produção animal. Associada à preservação dos espermatozoides, a inseminação artificial, oferece muitas vantagens aos criadores, uma vez que possibilita acelerar o melhoramento genético do rebanho, controlar as doenças sexualmente transmitidas, bem como, preservar o material genético de raças ameaçadas de extinção. No entanto, nos pequenos ruminantes a técnica é pouco difundida comparada com outras espécies. Isso se deve em parte aos resultados de fertilidade irregulares e geralmente, baixos obtidos com o uso de sêmen congelado. O artigo aborda de maneira sucinta as principais tecnicas utilizadas atualmente no processamento do sêmen e na IA em pequenos ruminantes e suas taxas de sucesso.

Semen processing and artificial insemination in goats and sheep / Tecnologia de sêmen e inseminação artificial em caprinos e ovinos

Artificial insemination (AI) is the oldest and most widely used assisted reproductive technique applied in livestock production. Associated with preservation of sperm, artificial insemination, offers many advantages to farmers, since it allows accelerating the genetic improvement of the herd, control sexually transmitted diseases, as well as preserve of the genetic material of endangered breeds. However, in small ruminants this technique is little used compared to other species. This is due to, in part, to the fertility results irregular and generally low obtained with the use of frozen semen. This paper discusses briefly the main technology currently used in the semen processing and AI in small ruminants and their success rates.(AU)

A inseminação artificial (IA) é a técnica de reprodução assistida, mais antiga e mais utilizada na produção animal. Associada à preservação dos espermatozoides, a inseminação artificial, oferece muitas vantagens aos criadores, uma vez que possibilita acelerar o melhoramento genético do rebanho, controlar as doenças sexualmente transmitidas, bem como, preservar o material genético de raças ameaçadas de extinção. No entanto, nos pequenos ruminantes a técnica é pouco difundida comparada com outras espécies. Isso se deve em parte aos resultados de fertilidade irregulares e geralmente, baixos obtidos com o uso de sêmen congelado. O artigo aborda de maneira sucinta as principais tecnicas utilizadas atualmente no processamento do sêmen e na IA em pequenos ruminantes e suas taxas de sucesso.(AU)

Effect of administering a diet contamined with fumonisins on the kidneys of wistar rats / Efeito da administração de ração contaminada com a micotoxina fumonisinas sobre os rins de ratos wistar

Fumonisins (FBs) are mycotoxins produced by Fusarium molds. Several works have shown contamination of maize by this toxin. Fumonisin B1 (FB-1) is found in greatest proportion (about 70%), resistant to several industrialization processes. In that context, the objective of this work was to analyze the effect of administering a diet contaminated with FB-1 on the morphophysiology of the kidneys of 21-day old male Wistar rats. The animals were divided into 2 groups: G0 (with animals receiving feed free of FBs) and G6 (6mg of FB1 kg-1 of feed). The diet was administered during 42 days. After that period, the animals were placed in metabolic cages for urine collection, blood was collected for analysis of plasma creatinine, and the kidneys were fixed and stained with Masson"s trichrome. We observed that FB1 administration did not affect feed intake, body weight gain and animal growth. The normal levels of plasma creatinine suggest that the toxin did not lead to glomerular lesion. There was also no change in water intake, osmolarity and excretion of sodium in urine. However, there was a significant increase in urine volume and potassium excretion in urine, with mild tubulointerstitial changes in the outer cortex for the group receiving the mycotoxin.(AU)

Fumonisinas (FBs) sمo micotoxinas produzidas por fungos do gênero Fusarium. Diversos trabalhos demonstraram a contaminaçمo do milho por essa toxina. A fumonisina B1 (FB-1) é encontrada em maior proporçمo (cerca de 70%), sendo resistente a vلrios processos de industrializaçمo. De acordo com este contexto, o trabalho em foco teve como objetivo analisar o efeito da administraçمo de dieta contaminada com FB-1 sobre a morfofisiologia renal de ratos Wistar machos, com 21 dias de idade. Os animais foram divididos em 2 grupos: G0 (raçمo isenta de FBs) e G6 (alimentados com 6mg de FB1 kg-1 de raçمo). A dieta foi administrada por 42 dias. Apَs esse perيodo, os animais foram colocados em gaiolas metabَlicas para coleta da urina, o sangue foi coletado para anلlise da creatinina plasmلtica, e os rins fixados e corados pelo Tricrômico de Masson. Observou-se que a administraçمo de FB1 nمo afetou o consumo de raçمo, o ganho de peso e crescimento dos animais. A normalidade nos nيveis da creatinina plasmلtica sugere que a toxina nمo induziu lesمo glomerular. Nمo houve alteraçمo na quantidade de لgua ingerida, na osmolaridade e na excreçمo urinلria do sَdio. No entanto houve aumento significativo no volume urinلrio e na excreçمo urinلria do potلssio e presença de alteraçُes tubulointersticiais de intensidade leve no cَrtex externo, no grupo que recebeu a micotoxina.(AU)