Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 5 de 5
Filtrar
Mais filtros

Base de dados
Tipo de documento
País de afiliação
Intervalo de ano de publicação
1.
Proc Natl Acad Sci U S A ; 113(44): 12532-12537, 2016 11 01.
Artigo em Inglês | MEDLINE | ID: mdl-27791128

RESUMO

Therapeutic targeting of the VEGF signaling axis by the VEGF-neutralizing monoclonal antibody bevacizumab has clearly demonstrated clinical benefit in cancer patients. To improve this strategy using a polyclonal approach, we developed a vaccine targeting VEGF using 3D-structured peptides that mimic the bevacizumab binding site. An in-depth study on peptide optimization showed that the antigen's 3D structure is essential to achieve neutralizing antibody responses. Peptide 1 adopts a clear secondary, native-like structure, including the typical cysteine-knot fold, as evidenced by CD spectroscopy. Binding and competition studies with bevacizumab in ELISA and surface plasmon resonance analysis revealed that peptide 1 represents the complete bevacizumab binding site, including the hairpin loop (ß5-turn-ß6) and the structure-supporting ß2-α2-ß3 loop. Vaccination with peptide 1 elicited high titers of cross-reactive antibodies to VEGF, with potent neutralizing activity. Moreover, vaccination-induced antisera displayed strong angiostatic and tumor-growth-inhibiting properties in a preclinical mouse model for colorectal carcinoma, whereas antibodies raised with peptides exclusively encompassing the ß5-turn-ß6 loop (peptides 15 and 20) did not. Immunization with peptide 1 or 7 (murine analog of 1) in combination with the potent adjuvant raffinose fatty acid sulfate ester (RFASE) showed significant inhibition of tumor growth in the B16F10 murine melanoma model. Based on these data, we conclude that this vaccination technology, which is currently being investigated in a phase I clinical trial (NCT02237638), can potentially outperform currently applied anti-VEGF therapeutics.


Assuntos
Bevacizumab/uso terapêutico , Neoplasias do Colo/tratamento farmacológico , Peptídeos/uso terapêutico , Vacinação/métodos , Fator A de Crescimento do Endotélio Vascular/antagonistas & inibidores , Sequência de Aminoácidos , Inibidores da Angiogênese/imunologia , Inibidores da Angiogênese/uso terapêutico , Animais , Anticorpos Neutralizantes/imunologia , Bevacizumab/imunologia , Sítios de Ligação/imunologia , Linhagem Celular Tumoral , Neoplasias do Colo/imunologia , Reações Cruzadas/imunologia , Humanos , Camundongos Endogâmicos BALB C , Camundongos Endogâmicos C57BL , Camundongos Nus , Terapia de Alvo Molecular/métodos , Peptídeos/química , Peptídeos/imunologia , Ratos Wistar , Fator A de Crescimento do Endotélio Vascular/imunologia , Ensaios Antitumorais Modelo de Xenoenxerto
2.
Chembiochem ; 16(1): 91-9, 2015 Jan 02.
Artigo em Inglês | MEDLINE | ID: mdl-25469830

RESUMO

Making peptide-based molecules that mimic functional interaction sites on proteins remains a challenge in biomedical sciences. Here, we present a robust technology for the covalent assembly of highly constrained and discontinuous binding site mimics, the potential of which is exemplified for structurally complex binding sites on the "Cys-knot" proteins hFSH and hCG. Peptidic structures were assembled by Ar(CH2 Br)2-promoted peptide cyclizations, combined with oxime ligation and disulfide formation. The technology allows unprotected side chain groups and is applicable to peptides of different lengths and nature. A tetracyclic FSH mimic was constructed, showing >600-fold improved binding compared to linear or monocyclic controls. Binding of a tricyclic hCG mimic to anti-hCG mAb 8G5 was identical to hCG itself (IC50 =260 vs. 470 pM), whereas this mimic displayed an IC50 value of 149 nM for mAb 3468, an hCG-neutralizing antibody with undetectable binding to either linear or monocyclic controls.


Assuntos
Materiais Biomiméticos/química , Gonadotropina Coriônica/química , Hormônio Foliculoestimulante/química , Peptídeos Cíclicos/química , Sequência de Aminoácidos , Anticorpos Monoclonais/química , Complexo Antígeno-Anticorpo/química , Sítios de Ligação , Materiais Biomiméticos/síntese química , Catálise , Ciclização , Dissulfetos/química , Humanos , Cinética , Modelos Moleculares , Dados de Sequência Molecular , Oximas/química , Peptídeos Cíclicos/síntese química , Ligação Proteica , Estrutura Secundária de Proteína
3.
J Mol Recognit ; 20(5): 283-99, 2007.
Artigo em Inglês | MEDLINE | ID: mdl-18074397

RESUMO

This paper describes immunization studies with CLIPS-constrained peptides covering only the major part (beta3-loop) of a structurally complex antigenic site on human Follicle Stimulating Hormone beta-subunit (FSH-beta). In cases where linear and SS-constrained peptides fail, the CLIPS-constrained peptides generate polyclonal antibodies with high neutralizing activity for hFSH. The sera were shown to be specific for hFSH over human Luteinizing Hormone (hLH) and human Chorionic Gonadotropin (hCG). ELISA-competition studies and circular dichroism (CD)-measurements illustrate clearly that activity of the peptides in antibody binding and generation relates directly to precise and appropriate fixation of the peptide conformation. Design of the CLIPS-peptides was entirely based on epitope mapping studies with two neutralizing anti-hFSH mAbs. Both mAbs were shown to bind to a conformational epitope located at the top of the beta1-beta3-loop covering the amino acid sequences Y58-P77 (beta3-loop). The results described in this paper show that CLIPS-constrained peptides covering the Y58-P77 sequence provide the minimally required structural entity necessary to generate reproducibly sera with high hFSH-neutralizing activity.


Assuntos
Epitopos/química , Mimetismo Molecular , Engenharia de Proteínas/métodos , Alanina , Sequência de Aminoácidos , Animais , Anticorpos Monoclonais/imunologia , Ligação Competitiva , Gonadotropina Coriônica/imunologia , Dicroísmo Circular , Mapeamento de Epitopos , Epitopos/imunologia , Hormônio Foliculoestimulante Humano/química , Humanos , Soros Imunes/imunologia , Imunização , Hormônio Luteinizante/imunologia , Camundongos , Dados de Sequência Molecular , Mutação/genética , Peptídeos/química , Peptídeos/imunologia , Estrutura Terciária de Proteína , Ratos , Proteínas Recombinantes/imunologia , Soluções
4.
Mol Divers ; 8(2): 61-77, 2004.
Artigo em Inglês | MEDLINE | ID: mdl-15209158

RESUMO

This paper describes the application of two novel screening technologies, i.e. Domain Scan (24- and 30-mer peptides) and Matrix Scan (24-mer peptides) technology, in the mapping of a discontinuous epitope on FSH-beta for a series of 20 monoclonal antibodies. 11 out of 20 mAb's, mapping of which was not successful by conventional Pepscan technology (12-mer peptides), showed selective binding to peptide-constructs corresponding to the beta3-loop of FSH in the Domain and/or Matrix Scan. Systematic replacement analysis studies with peptide-construct 57VYETVRVPGCAC-SAc-ADSLYTYPVATQ81 revealed that for most mAb's the amino acids R62, A70, D71, and L73 form the core of the epitope. A Domain Scan performed in the C-O format showed highly selective binding for mAb's 1 and 2 with only three beta1-beta3 peptide-constructs covering the residues 60TVRVPGCAHHADSLY74 in combination with 10IAIEKEECRFAI21, while for mAb 10 binding was observed with peptide-constructs containing the C-terminal residues 97RGLGPSYCSFGEMKE114 in combination with the residues 10IAIEKEECRFAI21. A Matrix Scan of mAb 17 showed that peptides from four different regions on FSH (1st strand beta3-loop, alpha 1-loop, long alpha2-loop, det. loop) showed enhanced binding in combination with several 70ADSL73-containing peptides. BIACORE measurements with mAb's 1, 2, 13, and 17 using a set of 21 different peptide(-construct)s partially confirmed the Domain and Matrix Scan screening results. Only 24- and 33-mer peptides covering both the 1st and 2nd strand of the beta3-loop showed measurable binding. Cyclic beta3-loop peptide mimics were found to bind significantly stronger (Kd approximately 5 microM) than the lineair analogues, in agreement with the fact that the discontinuous epitope is part of a loop structure. Coupling of the lineair beta1-peptide 1oIAIEKEECRFAI21 to the linear beta3-peptide *52TFKELVYETVRVPGCAHHADSLYTYPVATQAH83# via disulfide bond formation showed a 2-3 fold increase in Kd, thus conforming participation of the beta 1-loop in antibody binding for these mAb's.


Assuntos
Mapeamento de Epitopos/métodos , Subunidade beta do Hormônio Folículoestimulante/metabolismo , Análise Serial de Proteínas/métodos , Sequência de Aminoácidos , Substituição de Aminoácidos , Anticorpos Monoclonais/metabolismo , Sítios de Ligação , Bioquímica/métodos , Subunidade beta do Hormônio Folículoestimulante/química , Dados de Sequência Molecular , Conformação Proteica , Estrutura Terciária de Proteína
SELEÇÃO DE REFERÊNCIAS
DETALHE DA PESQUISA