Pinpointing Moisture: The Capacitive Detection for Standing Tree Health.

BACKGROUND: the feasibility of the capacitance method for detecting the water content in standing tree trunks was investigated using capacitance-based equipment that was designed for measuring the water content of standing tree trunks. METHODS: In laboratory experiments, the best insertion depth of the probe for standing wood was determined by measurement experiments conducted at various depths. The bark was to be peeled when specimens and standing wood were being measured. The actual water content of the test object was obtained by specimens being weighed and the standing wood being weighed after the wood core was extracted. RESULTS: A forecast of the moisture content of standing wood within a range of 0 to 180% was achieved by the measuring instrument. The feasibility of the device for basswood and fir trees is preliminarily studied. When compared to the drying method, the average error of the test results was found to be less than 8%, with basswood at 7.75%, and fir at 7.35%. CONCLUSIONS: It was concluded that the measuring instrument has a wide measuring range and is suitable for measuring wood with low moisture content, as well as standing timber with high moisture content. The measuring instrument, being small in size, easy to carry, and capable of switching modes, is considered to have a good application prospect in the field of forest precision monitoring and quality improvement.

Computational Insights into Reproductive Toxicity: Clustering, Mechanism Analysis, and Predictive Models.

Reproductive toxicity poses significant risks to fertility and progeny health, making its identification in pharmaceutical compounds crucial. In this study, we conducted a comprehensive in silico investigation of reproductive toxic molecules, identifying three distinct categories represented by Dimethylhydantoin, Phenol, and Dicyclohexyl phthalate. Our analysis included physicochemical properties, target prediction, and KEGG and GO pathway analyses, revealing diverse and complex mechanisms of toxicity. Given the complexity of these mechanisms, traditional molecule-target research approaches proved insufficient. Support Vector Machines (SVMs) combined with molecular descriptors achieved an accuracy of 0.85 in the test dataset, while our custom deep learning model, integrating molecular SMILES and graphs, achieved an accuracy of 0.88 in the test dataset. These models effectively predicted reproductive toxicity, highlighting the potential of computational methods in pharmaceutical safety evaluation. Our study provides a robust framework for utilizing computational methods to enhance the safety evaluation of potential pharmaceutical compounds.

Localization of an IgE epitope of glycinin A2 peptide chain.

INTRODUCTION: One of the main allergens in soybeans is glycinin, which seriously impacts the normal lives of allergic people. Previous studies have confirmed that thermal processing and thermal processing combined with ultrahigh-pressure processing could significantly reduce the antigenicity of glycinin. The dominant antigen region of acidic peptide chain A2 of G2 subunit was located by phage display experiment. METHODS: In this paper, overlapping peptides and alanine substitution techniques were used to explore the key amino acids that significantly affect the antigenicity of A2 peptide chain. The purity of peptide 1, peptide 2 and peptide 3 was identified by mass spectrometry and high-performance liquid chromatography, and the results showed that the purity of the synthesized overlapping peptide was more than 90%. SDS-PAGE showed that the peptide was successfully coupled with bovine serum albumin. The antigenicity of the coupling peptide was tested by ELISA and Dot-Blot, and the allergenicity was detected by reacting with the serum of patients with soybean globulin allergy. CONCLUSION: The results showed that peptide 3 has stronger antigenicity and sensitization. Alanine substitution technology allowed one to perform site-directed mutagenesis on peptide 3. Dot-Blot and ELISA tests showed that D259, E260, E261, Q263 and C266 may be the key amino acids that significantly affect the antigenicity of peptide 3. The research presented is of great significance for correctly guiding the production of safe food and preventing the occurrence of food allergic diseases. © 2023 Society of Chemical Industry.

Understanding the wetting discrepancy in calcium alumino silicate hydrate induced by Al/Si ratio.

The application of supplementary cementitious materials (SCMs) in concrete can improve its durability in the marine environment. Calcium alumino silicate hydrate (CASH) is the main hydration product of SCMs; however, to date, the mechanism of the wetting discrepancy in CASH with different Al/Si ratios has not been revealed at the molecular scale. Herein, the molecular dynamics simulation method was used to study the wettability of water nanodroplets on the surface of CASH substrates with different Al/Si ratios, aiming to reveal the influence of CASH gel with different Al contents on the wettability of water molecules. The simulation results suggested that the CASH interface with a high Al/Si ratio has better wettability for nanodroplets. The microcosmic analysis showed that the interaction between particles and the CASH substrate is affected by the Al content. The electronegativity of the CASH substrate increases due to the substitution of Al-O tetrahedrons, which makes it stronger to solidify Ca ions on its surface and easier to form hydrogen bonds with water molecules in a nanodroplet. The orientation distribution of water molecules further revealed the source of the force of the CASH substrate on nanodroplets at the atomic level. The analysis of the dynamic properties showed that the H-bonds between CASH substrate with a high Al/Si ratio and water molecules are more stable, and thus the nanodroplets have better stability on the surface of CASH.

Localization of G1A1a Allergenic Domain Destroyed by Thermal Processing.

Glycinin is an important allergenic protein. A1a is the acidic chain of the G1 subunit in glycinin (G1A1a), and it has strong allergenicity. In this study, we used phage display technology to express the protein of G1A1a and its overlapping fragments and an indirect enzyme-linked immunosorbent assay (iELISA) to determine the antigenicity and allergenicity of the expressed protein. After three rounds of screening, it was determined that fragment A1a-2-B-I (151SLENQLDQMPRRFYLAGNQEQEFLKYQQEQG181) is the allergenic domain of G1A1a destroyed by thermal processing. In addition, three overlapping peptides were synthesized from fragments A1a-2-B-I, and a linear epitope was found in this domain through methods including dot blot and iELISA. Peptide 2 (157DQMPRRFYLANGNQE170) showed allergenicity, and after replacing it with alanine, it was found that amino acids D157, Q158, M159, and Y164 were the key amino acids that affected its antigenicity, while Q158, M159, R162, and N168 affected allergenicity.

Localization and identification of denatured antigenic sites of glycinin A3 subunit after using two processing technologies.

Glycinin is an important allergen in soybeans. In this study, molecular cloning and recombinant phage construction were performed to explore the antigenic sites of the glycinin A3 subunit that were denatured during processing. Next, the A-1-a fragment was located as the denatured antigenic sites by indirect ELISA. The combined UHP heat treatment showed better denaturation of this subunit than the single heat treatment assay. In addition, identification of the synthetic peptide showed that the A-1-a fragment was an amino acid sequence containing a conformational and linear IgE site, in which the first synthetic peptide (P1) being both an antigenic and allergenic site. The results of alanine-scanning showed that the key amino acids affecting antigenicity and allergenicity of A3 subunit were S28, K29, E32, L35 and N13. Our results could provide the basis for further development of more efficient methods to reduce the allergenicity of soybeans.

Adhesion Performance of Ettringite at the Interface with Silane and GO/Silane: Insights into Molecular Dynamics Simulations.

The application of silane in sulfoaluminate cement repair materials can improve its waterproof, permeability, freeze-thaw, and other properties, but it would reduce the mechanical properties of sulfoaluminate cement-based materials, making it unable to better meet the engineering requirements and durability indices. The modification of silane with graphene oxide (GO) can effectively address this issue. However, the failure mechanism of the interface between silane and sulfoaluminate cement-based materials and the modification mechanism of GO remain unclear. In this paper, the interface-bonding mechanical models of isobutyltriethoxysilane (IBTS)/ettringite and GO-IBTS/ettringite are established by molecular dynamics method to study the source of interface-bonding properties of IBTS, GO-IBTS, and ettringite, as well as the failure mechanism of interface bonding, to reveal the mechanism of GO-modifying IBTS to improve the interface-bonding properties of IBTS and ettringite. This study finds that the bonding properties of the IBTS, GO-IBTS, and ettringite interface are derived from the amphiphilic nature of IBTS, which can only produce unilateral bonding with ettringite, thus becoming a weak link in interface dissociation. The double-sided nature of GO functional groups enables GO-IBTS to interact well with bilateral ettringite, thus enhancing the interface-bonding properties.

Establishment of DAS-ELISA for the detection of antigenic changes in glycinin after heat processing.

In this study, a double antibody sandwich enzyme-linked immunosorbent assay (DAS-ELISA) method was established to detect the antigenic changes of thermally processed products containing glycinin. The proposed DAS-ELISA method used heat-treated antigen-absorbing antiserum as the coating antibody, and horseradish peroxidase (HRP)-labeled rabbit anti-glycinin polyclonal antibody as the detection antibody. The specificity test results which were obtained using the proposed method indicated that good specificity had been achieved. The cut-off value was 0.388, and the LOD was determined to be 19.53 ng/mL. The coefficient of variation was less than 5.25% (intra-day) and 9.50% (inter-day). In this study's milk powder addition test, the recovery rate of the glycinin ranged between 83.65% and 90.13%. The established DAS-ELISA method was also used to detect soybean thermal processing products, such as soy sauce, steamed fish and soy sauce, soybean paste, beef sauce, soy milk powder, and tofu. The results showed that the OD450 values of the aforementioned products were lower than the OD450 values of the glycinin in defatted soybean flour. Therefore, it was indicated that the above products has undergone different degrees of thermal processing. In other words, the majority of the epitopes of glycinin in the products had been destroyed by the thermal processing and could not be combined with heat-treated antigen-absorbing antiserum.

An efficient conservative treatment modality for cervical pregnancy: angiographic uterine artery embolization followed by immediate curettage.

OBJECTIVE: We sought to evaluate a conservative treatment modality, angiographic uterine artery embolization (UAE) followed by immediate curettage, in the treatment of cervical pregnancy. STUDY DESIGN: Sixteen patients with cervical pregnancy were first treated by UAE to control or prevent vaginal bleeding. Curettage of cervical canal was performed immediately after UAE to remove gestational tissue from the cervix. Clinical outcome assessments include vaginal bleeding, serum ß-human chorionic gonadotropin level, cervical mass, menstruation, fertility, and hospitalization time. RESULTS: Fifteen patients were successfully treated by UAE followed by immediate curettage. One patient at very early gestational age underwent UAE only. Quick regression of serum human chorionic gonadotropin level and cervical mass, fertility preservation, and a short hospital stay were observed. CONCLUSION: UAE followed by immediate curettage is an efficient conservative treatment for cervical pregnancy. This procedure may become a useful alternative to other conservative approaches.

Successful pregnancy following insertion of a levonorgestrel-releasing intrauterine system in two infertile patients with complex atypical endometrial hyperplasia.

Two infertile patients are presented with complex atypical endometrial hyperplasia becoming pregnant following conservative treatment with a levonorgestrel-releasing intrauterine system (LNG-IUS) insertion. Histological morphology of endometrial samples after 6 months' exposure to LNG-IUS showed secretory or atrophic glands with decidualized stroma. Two healthy babies were born following ovulation induction after removal of the LNG-IUS.

Free ammonia enhances dark fermentative hydrogen production from waste activated sludge.

Ammonium and/or free ammonia (the unionized form of ammonium) are generally thought to inhibit the activities of microbes involved in anaerobic digestion of waste activated sludge. It was found in this work, however, that the presence of ammonium (NH4+-N) largely enhanced dark fermentative hydrogen production from alkaline pretreated-sludge. With the increase of initial NH4+-N level from 36 to 266 mg/L, the maximal hydrogen production from alkaline (pH 9.5) pretreated-sludge increased from 7.3 to 15.6 mL per gram volatile suspended solids (VSS) under the standard condition. Further increase of NH4+-N to 308 mg/L caused a slight decrease of hydrogen yield (15.0 mL/g VSS). Experimental results demonstrated that free ammonia instead of NH4+-N was the true contributor to the enhancement of hydrogen production. It was found that the presence of free ammonia facilitated the releases of both extracellular and intracellular constituents, which thereby provided more substrates for subsequent hydrogen production. The free ammonia at the tested levels (i.e., 0-444 mg/L) did not affect acetogenesis significantly. Although free ammonia inhibited all other bio-processes, its inhibition to the hydrogen consumption processes (i.e., homoacetogenesis, methanogenesis, and sulfate-reducing process) was much severer than that to the hydrolysis and acidogenesis processes. Further investigations with enzyme analyses showed that free ammonia posed slight impacts on protease, butyrate kinase, acetate kinase, CoA-transferase, and [FeFe] hydrogenase activities but largely suppressed the activities of coenzyme F420, carbon monoxide dehydrogenase, and adenylyl sulfate reductase, which were consistent with the chemical analyses performed above.

Application of the nuclear factor-κB inhibitor pyrrolidine dithiocarbamate for the treatment of endometriosis: an in vitro study.

This study demonstrated that pyrrolidine dithiocarbamate (PDTC), a potent nuclear factor-κB inhibitor, showed stronger inhibitory effects on nuclear factor-κB activation in endometriotic stromal cells than in normal endometrial stromal cells as determined by electrophoretic mobility shift assay and Western blot analysis. Pretreatment of endometriotic stromal cells with PDTC attenuated tumor necrosis factor-α-induced expressions of CD44s, matrix metalloproteinase-9, and vascular endothelial growth factor whereas reversed tumor necrosis factor-α-reduced expressions of tissue inhibitor of metalloproteinase-1 revealed by reverse transcriptase polymerase chain reaction and Western blot analysis, suggesting that PDTC may represent a novel therapeutic strategy for treatment of endometriosis.