Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 109
Filtrar
Mais filtros

Base de dados
País/Região como assunto
Tipo de documento
Intervalo de ano de publicação
1.
Phys Rev Lett ; 124(20): 202501, 2020 May 22.
Artigo em Inglês | MEDLINE | ID: mdl-32501086

RESUMO

We measured missing mass spectrum of the ^{12}C(γ,p) reaction for the first time in coincidence with potential decay products from η^{'} bound nuclei. We tagged an (η+p) pair associated with the η^{'}N→ηN process in a nucleus. After applying kinematical selections to reduce backgrounds, no signal events were observed in the bound-state region. An upper limit of the signal cross section in the opening angle cosθ_{lab}^{ηp}<-0.9 was obtained to be 2.2 nb/sr at the 90% confidence level. It is compared with theoretical cross sections, whose normalization ambiguity is suppressed by measuring a quasifree η^{'} production rate. Our results indicate a small branching fraction of the η^{'}N→ηN process and/or a shallow η^{'}-nucleus potential.

2.
Clin Radiol ; 71(10): 953-959, 2016 Oct.
Artigo em Inglês | MEDLINE | ID: mdl-27421574

RESUMO

Idiopathic pneumonia syndrome (IPS) is an acute lung dysfunction of non-infectious aetiology and a severe complication following haematopoietic stem cell transplantation (HSCT). Recently, the American Thoracic Society (ATS) updated the concept of IPS and extended the concept to a wider range; it defined IPS as "an idiopathic syndrome of pneumopathy after HSCT, with evidence of widespread alveolar injury and in which infectious aetiologies and cardiac dysfunction, acute renal failure, or iatrogenic fluid overload have been excluded." The ATS also categorised the presumed site of primary tissue injury into three patterns (pulmonary parenchyma, vascular endothelium, and airway epithelium), each of which has several entities. Since the therapeutic strategies for IPS are clearly different from those of infectious diseases, and therapeutic delay causes a poor prognosis, radiologists should be aware of some characteristic HRCT findings of IPS, which includes a wide spectrum of entities. In this article, the characteristic HRCT findings of these entities, including acute interstitial pneumonia/acute respiratory distress syndrome, eosinophilic pneumonia, non-cardiogenic capillary leak syndrome, diffuse alveolar haemorrhage, transfusion-related acute lung injury, organising pneumonia, and bronchiolitis obliterans syndrome, are shown.


Assuntos
Transplante de Células-Tronco Hematopoéticas , Pneumonia/diagnóstico por imagem , Complicações Pós-Operatórias/diagnóstico por imagem , Tomografia Computadorizada por Raios X/métodos , Humanos , Pulmão/diagnóstico por imagem , Sociedades Médicas , Síndrome , Estados Unidos
3.
Clin Radiol ; 68(12): e669-75, 2013 Dec.
Artigo em Inglês | MEDLINE | ID: mdl-24025862

RESUMO

AIM: To evaluate the volumetric values of intrapulmonary clots (IPCs) using 64-section dual-energy perfusion computed tomography (DEpCT). MATERIALS AND METHODS: A total of 174 patients suspected of having acute pulmonary embolism (PE) underwent DEpCT, and acute PE was diagnosed in 48 of these patients. DEpCT images were three-dimensionally reconstructed with four threshold ranges: 1-120 HU (V120), 1-15 HU (V15), 1-10 HU (V10), and 1-5 HU (V5). Each relative value per V120 was expressed as %V15, %V10 and %V5. These values were compared with the d-dimer, pulmonary arterial (PA) pressure, right ventricular (RV) diameter, RV/left ventricular diameter ratio, PA diameter, and CT angiographic obstruction index (CTOI). RESULTS: In patients with IPCs, PA pressure, d-dimer and volumetric values of DEpCT were significantly higher (p < 0.001). Relative volumetric values at DEpCT had better correlations with the PA pressure, PA diameter, and CTOI than absolute ones, and %V5 especially had good correlations with PA pressure (r = 0.44, p = 0.02), PA diameter (r = 0.40, p = 0.005), and CTOI (r = 0.38, p = 0.009). CONCLUSION: The relative volumetric evaluation of DEpCT images with a lower attenuation threshold range may be helpful for assessing right heart strain, because these values had good correlation with CTOI, pulmonary pressure, and diameter in suggesting right heart load.


Assuntos
Embolia Pulmonar/diagnóstico por imagem , Tomografia Computadorizada por Raios X/métodos , Feminino , Humanos , Pulmão/diagnóstico por imagem , Pulmão/patologia , Masculino , Pessoa de Meia-Idade , Embolia Pulmonar/patologia , Veias Pulmonares/diagnóstico por imagem , Veias Pulmonares/patologia , Imagem Radiográfica a Partir de Emissão de Duplo Fóton/métodos , Índice de Gravidade de Doença
4.
Osteoporos Int ; 20(6): 935-42, 2009 Jun.
Artigo em Inglês | MEDLINE | ID: mdl-18825300

RESUMO

SUMMARY: Vitamin K and D deficiency and decreased bone mineral density (BMD) were highly prevalent in patients with inflammatory bowel disease (IBD), especially Crohn's disease (CD). Dietary intakes of these vitamins, however, were above the Japanese adequate intakes in IBD patients, suggesting that malabsorption is the basis for hypovitaminosis K and D and decreased BMD. INTRODUCTION: We have studied the possible involvement of vitamin K and D deficiency in the pathogenesis of decreased BMD in IBD. METHODS: Seventy patients with IBD were evaluated for their BMD; plasma levels of vitamin K; phylloquinone (PK), menaquinone-7 (MK-7), and 25OH-D; serum PTH, protein induced by vitamin K absence (PIVKA-II), and undercarboxylated osteocalcin (ucOC) levels; and their food intake. RESULTS: Compared with ulcerative colitis (UC) patients, CD patients had significantly lower plasma vitamin K and 25OH-D concentrations; significantly higher serum levels of PTH, PIVKA-II, and ucOC; and significantly lower BMD scores at almost all measurement sites. More IBD patients were vitamin K deficient in bone than in liver. Multiple regression analyses revealed that low plasma concentrations of vitamin K and 25OH-D were independent risk factors for low BMD and that they were associated with the patients' fat intake, but not with their intake of these vitamins. CONCLUSION: IBD patients have high prevalence of decreased BMD and vitamin K and D deficiency probably caused by malabsorption of these vitamins.


Assuntos
Densidade Óssea/fisiologia , Fraturas Ósseas/etiologia , Doenças Inflamatórias Intestinais/complicações , Síndromes de Malabsorção/complicações , Deficiência de Vitamina D/complicações , Deficiência de Vitamina K/complicações , Adulto , Colite Ulcerativa/sangue , Colite Ulcerativa/complicações , Doença de Crohn/sangue , Doença de Crohn/complicações , Dieta , Feminino , Humanos , Doenças Inflamatórias Intestinais/sangue , Síndromes de Malabsorção/sangue , Masculino , Estado Nutricional , Prevalência , Análise de Regressão , Fatores de Risco , Deficiência de Vitamina D/sangue , Deficiência de Vitamina K/sangue
5.
Biochim Biophys Acta ; 1445(2): 225-31, 1999 May 14.
Artigo em Inglês | MEDLINE | ID: mdl-10320775

RESUMO

SOX is a family of SRY-related genes, which encode transcriptional factors involved in development. In this study, we newly isolated and sequenced mouse cDNA clones for mSox7. The mSox7 gene encodes 380 amino acids containing an SRY-type HMG box. Genomic Southern analysis suggested that the mSox7 gene was a single-copy gene. Tissue specific expression of mSox7 was investigated by Northern analysis. The expression was restricted to the ovary and heart, and the size of the transcripts was estimated to be 3.6 knt. Electrophoretic mobility shift assay indicated that recombinant mSox7 polypeptide was capable of binding to a nucleotide sequence, AACAAT. Immunohistochemical study revealed that mSox7 protein was localized in oocytes in the mouse ovary.


Assuntos
DNA Complementar/química , Proteínas de Ligação a DNA/genética , Proteínas de Grupo de Alta Mobilidade/genética , Proteínas Nucleares , Fatores de Transcrição , Sequência de Aminoácidos , Animais , Sequência de Bases , DNA Complementar/isolamento & purificação , Proteínas de Ligação a DNA/química , Feminino , Proteínas de Grupo de Alta Mobilidade/química , Imuno-Histoquímica , Masculino , Camundongos , Dados de Sequência Molecular , Miocárdio/metabolismo , Oócitos/metabolismo , Ovário/metabolismo , Fatores de Transcrição SOXF , Proteína da Região Y Determinante do Sexo
6.
Biochim Biophys Acta ; 1399(1): 40-6, 1998 Jul 30.
Artigo em Inglês | MEDLINE | ID: mdl-9714725

RESUMO

The nucleotide sequence of mouse Sox5 (mSox5) cDNA derived from the testis has been reported by Denny et al. (EMBO J. 11 (1992) 3705-3712). We newly isolated an mSox5 cDNA derived from 8.5-day mouse embryo. Our cDNA encodes a protein of 763 amino acids, which is considerably larger in size than the previous one (392 amino acids) derived from the adult mouse testis. The most significant difference between the embryo-derived and testis-derived mSox5 cDNAs is that the embryonic one encodes a leucine zipper motif and a neighboring glutamine-rich sequence stretch (named Q box), but the testis-derived one does not. The leucine zipper and the Q box are highly conserved among type-D SOX proteins including mSox5. mSox5 was suggested to be a single-copy gene by Southern analysis. With reverse transcription/polymerase chain reaction, we found that not only mouse embryo, but also the adult mouse testis, express mSox5 mRNA species encoding the leucine zipper and the Q box.


Assuntos
Proteínas de Ligação a DNA/genética , Zíper de Leucina , Proteínas Nucleares/genética , Sequência de Aminoácidos , Animais , Sequência de Bases , DNA Complementar/química , Proteínas de Ligação a DNA/química , Embrião de Mamíferos/metabolismo , Masculino , Camundongos , Dados de Sequência Molecular , Proteínas Nucleares/química , Fatores de Transcrição SOXD , Testículo/metabolismo
7.
J Mol Biol ; 235(2): 793-4, 1994 Jan 14.
Artigo em Inglês | MEDLINE | ID: mdl-8289303

RESUMO

The vitelline membrane outer layer protein I (VMO-I), which is isolated from the vitelline membrane outer layer of hen's eggs, has been crystallized from an acetate buffer solution by the hanging-drop method. The crystals belong to the orthorhombic space group P2(1)2(1)2(1), with unit cell dimensions a = 62.42 A, b = 110.52 A, c = 44.15 A. There are two molecules (M(r) = 18,000) per asymmetric unit. The crystals diffract to at least 2.2 A Bragg spacings.


Assuntos
Proteínas do Ovo/química , Proteínas de Membrana/química , Membrana Vitelina/química , Animais , Galinhas , Cristalização , Cristalografia por Raios X
8.
Aliment Pharmacol Ther ; 21 Suppl 2: 73-8, 2005 Jun.
Artigo em Inglês | MEDLINE | ID: mdl-15943851

RESUMO

AIM: We investigated the effect of acid suppression therapy on recurrent bleeding after successful endoscopic treatment of bleeding peptic ulcer. METHODS: A total of 400 patients with bleeding peptic ulcer received either intravenous infusion of famotidine (40 mg/day) (n = 207, 163 males, 44 females, mean age 61.5 years) or drip infusion of omeprazole (40 mg/day; n = 193, 134 males, 59 females, mean age 59.8 years) after successful endoscopic treatment. The fasting duration, hospital stay, volume of transfused blood, incidence of rebleeding and mortality were compared between the two groups. RESULTS: The incidence of rebleeding did not differ significantly between the famotidine group (9%) and the omeprazole group (8%). The mean hospital stay was significantly shorter in the omeprazole group (18.4 days) than in the famotidine group (21.5 days, P = 0.009). However, there was no statistically significant difference in fasting duration, volume of transfused blood or mortality. CONCLUSION: Our findings indicate that intravenous infusion of famotidine after successful endoscopic treatment is equivalent to drip infusion of omeprazole for prevention of recurrent bleeding.


Assuntos
Antiulcerosos/administração & dosagem , Famotidina/administração & dosagem , Úlcera Péptica Hemorrágica/prevenção & controle , Adolescente , Adulto , Idoso , Idoso de 80 Anos ou mais , Antiácidos/uso terapêutico , Transfusão de Sangue , Endoscopia Gastrointestinal , Feminino , Hemostase Endoscópica , Humanos , Infusões Intravenosas , Tempo de Internação , Masculino , Pessoa de Meia-Idade , Omeprazol/administração & dosagem , Úlcera Péptica Hemorrágica/cirurgia , Prevenção Secundária , Resultado do Tratamento
9.
Endocrinology ; 142(6): 2205-12, 2001 Jun.
Artigo em Inglês | MEDLINE | ID: mdl-11356664

RESUMO

Osteoprotegerin (OPG) is a recently identified member of the tumor necrosis factor (TNF) receptor superfamily that regulates bone mass through an inhibitory action on osteoclast differentiation and function. To determine its potential roles of OPG in pathological changes in bone metabolism caused by estrogen deficiency, we investigated effects of estrogen on OPG expression by a mouse stromal cell line, ST-2, in vitro. Treatment of ST-2 cells with 17beta-E(2) resulted in up-regulation of OPG expression at both the messenger RNA and protein levels. The effect was time and dose dependent and steroid specific. The stimulatory action of 17beta-E(2) on OPG expression appeared to be mediated by the estrogen receptor-alpha (ERalpha) subtype because stable overexpression of ERalpha, but not of ERbeta, enhanced the OPG induction by 17beta-E(2). Moreover, estrogen withdrawal after 5-day pretreatment, mimicking the event occurring in vivo at menopause, dramatically diminished the expression of OPG. These findings suggest that down-regulation of OPG after estrogen withdrawal contributes to the enhanced osteoclastic bone resorption and bone loss after menopause by enhancing RANK ligand-RANK system that lies downstream of a large number of bone-resorbing cytokines.


Assuntos
Estradiol/farmacologia , Expressão Gênica/efeitos dos fármacos , Glicoproteínas/genética , Receptores Citoplasmáticos e Nucleares/genética , Receptores de Estrogênio/fisiologia , Células Estromais/metabolismo , Animais , Linhagem Celular , Relação Dose-Resposta a Droga , Estradiol/administração & dosagem , Receptor alfa de Estrogênio , Glicoproteínas/análise , Humanos , Cinética , Camundongos , Osteoprotegerina , RNA Mensageiro/análise , Receptores Citoplasmáticos e Nucleares/análise , Receptores de Estrogênio/efeitos dos fármacos , Receptores do Fator de Necrose Tumoral
10.
Gene ; 144(2): 311-2, 1994 Jul 08.
Artigo em Inglês | MEDLINE | ID: mdl-8039720

RESUMO

Two cDNAs encoding hen vitelline membrane outer layer protein I (VMO-I), which is classified as a new type of multi-beta-sheet assembly, were cloned and sequenced. Northern blot analysis using vmo-I cDNA as a probe showed the presence of three mRNA species. Strikingly, expression of these mRNAs was restricted to a specific region of the hen oviduct, the area joining the infundibulum to the magnum.


Assuntos
Proteínas do Ovo/genética , Sequência de Aminoácidos , Animais , Sequência de Bases , Galinhas , Clonagem Molecular , DNA Complementar , Feminino , Dados de Sequência Molecular , RNA Mensageiro/genética
11.
Gene ; 208(2): 201-6, 1998 Feb 27.
Artigo em Inglês | MEDLINE | ID: mdl-9524265

RESUMO

A novel SRY-related cDNA, mSox13, was isolated from a lambda phage library derived from mouse embryo. The cDNA encodes a protein of 595 amino acids containing the SRY-type high mobility group (HMG) box and a putative leucine zipper motif. A sequence comparison of mSox13 and other type-D SOX proteins shows that the leucine zipper and a neighboring glutamine-rich sequence stretch, which was named Q box, are well conserved among known type-D SOX proteins. The expression of mSox13 is restricted to the kidney and ovary. The electrophoretic mobility shift assay indicates that the recombinant mSox13 protein is capable of binding to the AACAAT sequence.


Assuntos
Autoantígenos , Proteínas de Grupo de Alta Mobilidade/biossíntese , Camundongos/genética , Proteínas Nucleares , Fatores de Transcrição , Sequência de Aminoácidos , Animais , Sequência de Bases , Sítios de Ligação , Clonagem Molecular , DNA Complementar , Proteínas de Ligação a DNA/química , Embrião de Mamíferos , Biblioteca Gênica , Proteínas de Grupo de Alta Mobilidade/química , Zíper de Leucina , Dados de Sequência Molecular , Oligodesoxirribonucleotídeos/química , Oligodesoxirribonucleotídeos/metabolismo , Especificidade de Órgãos , Proteínas Recombinantes/biossíntese , Proteínas Recombinantes/química , Alinhamento de Sequência , Homologia de Sequência de Aminoácidos , Proteína da Região Y Determinante do Sexo , Especificidade por Substrato
12.
Eur J Cancer ; 37(12): 1482-7, 2001 Aug.
Artigo em Inglês | MEDLINE | ID: mdl-11506954

RESUMO

Gastric carcinoma cells express potent angiogenic factors including vascular endothelial growth factor (VEGF). We previously reported that interleukin-8 (IL-8) acts as an angiogenic factor for human gastric carcinomas. More recently, we found that IL-8 upregulates matrix metalloproteinase-9 (MMP-9) expression and increases invasive activity of gastric carcinoma cells. The purpose of this study was to determine whether the expression of IL-8 and VEGF correlates with clinicopathological parameters in human gastric carcinomas. IL-8 and VEGF expression levels were measured by an enzyme-linked immunosorbent assay (ELISA) in 56 gastric carcinomas and the surrounding normal mucosa. Macroscopic and histopathological tumour findings, presence of metastasis and prognosis were obtained from the patient records and endoscopic, surgical and pathological reports. IL-8 protein levels were higher in most neoplasms than in the corresponding normal mucosal tissue. In contrast, VEGF expression in the tumours was similar to that in normal mucosa. The IL-8 level in the neoplasms correlated significantly with the depth of invasion, venous invasion and lymphatic invasion. VEGF expression in the tumours correlated well with the depth of invasion and lymph node metastasis. No correlation between IL-8 and VEGF expression in the tumours was observed. The survival rates of patients with tumours displaying high IL-8 and VEGF expression levels were significantly lower (P<0.05) than those of patients with tumours displaying low IL-8 and VEGF expression. The results suggest that IL-8 and VEGF may be independent and important prognostic factors in human gastric carcinomas.


Assuntos
Fatores de Crescimento Endotelial/metabolismo , Interleucina-8/metabolismo , Linfocinas/metabolismo , Neoplasias Gástricas/irrigação sanguínea , Adulto , Idoso , Idoso de 80 Anos ou mais , Progressão da Doença , Ensaio de Imunoadsorção Enzimática , Mucosa Gástrica/irrigação sanguínea , Mucosa Gástrica/metabolismo , Humanos , Metástase Linfática/diagnóstico , Pessoa de Meia-Idade , Análise Multivariada , Invasividade Neoplásica/diagnóstico , Neovascularização Patológica/diagnóstico , Prognóstico , Neoplasias Gástricas/metabolismo , Fator A de Crescimento do Endotélio Vascular , Fatores de Crescimento do Endotélio Vascular
13.
Pediatrics ; 89(3): 379-83, 1992 Mar.
Artigo em Inglês | MEDLINE | ID: mdl-1311067

RESUMO

Oral acyclovir was given prophylactically to 37 children in the early stages of three outbreaks of herpes simplex virus type 1 (HSV-1) infection and the results were compared with those in untreated control subjects in two other outbreaks. The rates of seroconversion to HSV were significantly reduced in children treated with acyclovir compared with control subjects (91% vs 27%, P less than .001). The incidence of symptomatic disease was also significantly reduced (82% vs 0%, P less than .001). In some children receiving prophylactic acyclovir, anti-HSV antibody titers did not rise despite the presence of replicative HSV on throat swabs just before the start of treatment. Restriction endonuclease analysis of isolated HSV-DNA confirmed that one strain was responsible for the five outbreaks. No resistance to acyclovir was detected during the study, and no adverse effects of treatment were noted. In conclusion, short-term prophylactic acyclovir may limit the spread and reduce clinical manifestations of HSV infections in closed communities, although this use should be restricted to communities where severe symptoms are observed.


Assuntos
Aciclovir/administração & dosagem , Enzimas de Restrição do DNA/análise , DNA Viral/análise , Surtos de Doenças/prevenção & controle , Marcadores Genéticos , Herpes Simples/prevenção & controle , Berçários para Lactentes , Simplexvirus/genética , Administração Oral , Pré-Escolar , Herpes Simples/epidemiologia , Humanos , Lactente , Simplexvirus/classificação , Simplexvirus/efeitos dos fármacos
14.
Pediatrics ; 87(2): 152-8, 1991 Feb.
Artigo em Inglês | MEDLINE | ID: mdl-1846235

RESUMO

The clinical features and the molecular epidemiology of primary herpes simplex virus type 1 (HSV-1) infection among children younger than 3 years of age were investigated in day-care nursery. Serial sera were assayed for anti-HSV-1 glycoprotein B antibody by enzyme-linked immunosorbent assay. Serologic examinations revealed 55 cases of primary HSV infection during the observation period. Fifty-one of them (93%) had typical herpetic gingivostomatitis, showing a high rate of clinically overt infection. Four outbreaks of herpetic gingivostomatitis were observed during the observation period. Forty-one children were infected with HSV-1 in the outbreaks. The rates of infection in the susceptible children were 81%, 73%, 78%, and 100%, respectively, in the four outbreaks. Restriction endonuclease analysis of DNA of isolated HSV revealed that only one strain of HSV-1 had been transmitted among children for a long period.


Assuntos
Creches , Estomatite Herpética/epidemiologia , Fatores Etários , Anticorpos Antivirais/análise , Pré-Escolar , Enzimas de Restrição do DNA , DNA Viral/análise , Ensaio de Imunoadsorção Enzimática , Feminino , Humanos , Lactente , Recém-Nascido , Masculino , Simplexvirus/genética , Simplexvirus/imunologia , Simplexvirus/isolamento & purificação , Estomatite Herpética/diagnóstico , Estomatite Herpética/transmissão , Proteínas do Envelope Viral/imunologia , Vírion/imunologia
15.
Invest Radiol ; 28(6): 482-7, 1993 Jun.
Artigo em Inglês | MEDLINE | ID: mdl-8320065

RESUMO

RATIONALE AND OBJECTIVES: Dual-energy subtraction radiography using computed radiography (CR) can aid in the detection of pulmonary abnormalities such as nodules, but the subtracted image requires higher x-ray exposure than usual to reduce quantum mottle. To reduce quantum mottle without increasing x-ray exposure, a new dual-energy subtraction algorithm was investigated that included an edge-adaptive smoothing process and a subtraction process. The signal-to-noise ratio and the image quality of this new subtracted image was significantly superior to that of conventional subtracted images. METHODS: Observer performance of the subtracted digital radiography in detecting simulated pulmonary nodules was compared with original CR images and conventional subtracted digital radiography of 50 patients. RESULTS: A combination of an original CR image and a new subtracted CR image was significantly superior to a single original CR image or a combination of an original CR image and a conventional subtracted CR image (P < .01). DISCUSSION: The single-exposure dual-energy subtraction method is superior to the conventional subtraction method in the detection of pulmonary nodules.


Assuntos
Modelos Estruturais , Interpretação de Imagem Radiográfica Assistida por Computador , Imagem Radiográfica a Partir de Emissão de Duplo Fóton , Radiografia Torácica , Nódulo Pulmonar Solitário/diagnóstico por imagem , Humanos
16.
Invest Radiol ; 29(2): 172-7, 1994 Feb.
Artigo em Inglês | MEDLINE | ID: mdl-8169093

RESUMO

RATIONALE AND OBJECTIVES: The effectiveness of a computerized analysis system to detect and characterize interstitial lung abnormalities seen on chest radiographs was evaluated. This method included a process of four-directional Laplacian-Gaussian filtering and a process of linear opacity judgement. For quantitative analysis of interstitial opacities, the radiographic index, which is the percentage of opacity areas in a region of interest, was obtained and evaluated in the images. These opacities represented interstitial lung abnormalities. METHODS: Two regions of interest were selected in each right lung of 50 patients with normal lung parenchyma and 50 patients with diffuse interstitial lung abnormalities, confirmed with high-resolution computed tomography. These regions of interest were processed by our computerized analysis system. RESULTS: Abnormal lungs were well differentiated from normal lungs by the radiographic indices obtained from the images filtered by four-directional Laplacian-Gaussian filters and from those processed by linear opacity judgement. However, honeycomb lesions and other interstitial abnormalities (interstitial changes other than honeycombing) were differentiated from each other only by the radiographic indices obtained from the image processed by linear opacity judgment (P < .05). DISCUSSION: These results indicate that this system is useful for the detection and characterization of interstitial lung abnormalities.


Assuntos
Doenças Pulmonares Intersticiais/diagnóstico por imagem , Pulmão/diagnóstico por imagem , Interpretação de Imagem Radiográfica Assistida por Computador , Feminino , Humanos , Processamento de Imagem Assistida por Computador , Doenças Pulmonares Intersticiais/classificação , Masculino , Pessoa de Meia-Idade , Tomografia Computadorizada por Raios X
17.
J Biochem ; 81(5): 1543-8, 1977 May.
Artigo em Inglês | MEDLINE | ID: mdl-893361

RESUMO

A glycoprotein fraction (GP-II) has been isolated from the vitelline membrane of hen's egg and its physicochemical properties clarified. GP-II is composed of polypeptide (92%), neutral sugar (4%), hexosamine (3.3%), and sialic acid (0.6%). The constituent neutral sugars of this glycoprotein are fucose, mannose, and galactose, in a molar ratio of 2:6:5. An interesting feature of the amino acid composition of GP-II is the high proportion of proline. GP-II exists in an aggregated form and is hydrophobic in nature. Upon velocity sedimentation in 0.5% SDS solution, it showed a hypersharp boundary with an apparent sedimentation coefficient of 5.6 S. Reduction of GP-II, however, gave a single component of 3.6 S which seems to be a subunit of GP-II.


Assuntos
Proteínas do Ovo , Glicoproteínas , Proteínas de Membrana , Membrana Vitelina/análise , Aminoácidos/análise , Animais , Carboidratos/análise , Galinhas , Proteínas do Ovo/isolamento & purificação , Feminino , Glicoproteínas/isolamento & purificação , Proteínas de Membrana/isolamento & purificação , Peso Molecular
18.
J Biochem ; 78(2): 261-8, 1975 Aug.
Artigo em Inglês | MEDLINE | ID: mdl-1241694

RESUMO

The vitelline membrane of hen's egg has been successfully solubilized in sodium dodecyl sulfate (SDS), guanidine hydrochloride and urea solutions, and its macromolecular components examined. SDS-gel electrophoresis of the membrane solution revealed the presence of three major components designated I, II, and III, all containing carbohydrate and protein. The approximate molecular weights of components I and II were 32,000 and 260,000, respectively, and the sedimentation coefficients were 2.2S and 4.3S. Component III was in an aggregated form which disintegrated into smaller components upon reduction with 2-mercaptoethanol. It was found that component II (4.3S component) deteriorated during storage of the egg with the concomitant formation of degraded components. The loss of this component was accompanied by a gradual decrease of the neutral sugar content of the vitelline membrane. On the basis of these data, the membrane structure and its deterioration during storage are discussed.


Assuntos
Carboidratos/análise , Proteínas do Ovo/análise , Membrana Vitelina/análise , Envelhecimento , Animais , Galinhas , Estabilidade de Medicamentos , Ovos , Eletroforese em Gel de Poliacrilamida , Feminino , Peso Molecular
19.
J Biochem ; 79(6): 1351-6, 1976 Jun.
Artigo em Inglês | MEDLINE | ID: mdl-956159

RESUMO

Of the three major macromolecular components of the vitelline membrane of hen's egg, the lowest molecular weight component (previously designated component I) has been studied and its physicochemical properties clarified. The molecular weight of this component is 27,000 and its chemical composition is typical of a glycoprotein, consisting of protein (91%), total hexose (4.4%), hexosamine (glucosamine 2.3%; galactosamine 0.7%), and sialic acid (1.7%). Uronic acid was not found. The molar ratios of the constituent neutral sugars of this glycoprotein (GP-1) are as follows: fucose 3, mannose 5, galactose 5, glucose 1, and xylose 1. The amino acid profile shows a relatively high proportion of hydrophobic amino acids (39%), which may partly account for the insolubility of GP-I in water.


Assuntos
Glicoproteínas , Membrana Vitelina/análise , Aminoácidos/análise , Animais , Galinhas , Cromatografia Gasosa , Feminino , Fucose/análise , Glicoproteínas/isolamento & purificação , Hexosaminas/análise , Hexoses/análise , Peso Molecular , Ácidos Siálicos/análise , Ácidos Urônicos/análise
20.
J Biochem ; 117(6): 1183-91, 1995 Jun.
Artigo em Inglês | MEDLINE | ID: mdl-7490258

RESUMO

Vitelline membrane outer layer protein I (VMO-I) tightly bound to ovomucin fibrils of hen's egg yolk membrane was characterized in terms of its amino acid sequence and structural stability. The deduced sequence of VMO-I using the conventional sequencing method is: RTREYTSVITVPNGGHWGKWGIRQFCHSGYANGFALKVEPSQFGRDDTALNGIRLRCLD- GSVIESLVGKWGTWTSFLVCPTGYLVSFSLRSEKSQGGGDDTAANNIQFRCSDEAVLVGD- DLSWGRFGPWSKRCKICGLQTKVESPQGLRDDTALNNVRFFCCK. Thus, VMO-I is composed of 163 amino acid residues with a calculated molecular weight of 17,979. The sequence confirms the cDNA sequence of VMO-I we recently determined and does not show any significant similarity to proteins compiled in the NBRF database. Two of the four disulfide bonds found in VMO-I were estimated to lie between Cys26 and Cys57 and between Cys79 and Cys110. The sequence analyses show that VMO-I contains three 53-residue internal repeats that contain distinctive regions of turns flanked by beta-sheets consistent with the recent finding that the molecule contains a new beta-fold motif, the beta-prism. The molecular characteristics of VMO-I in solution were examined by CD spectroscopy in the far and near ultraviolet regions, NMR spectroscopy, and high sensitive differential scanning calorimetry (DSC). CD spectra in the far UV region at room temperature were similar to that assigned to a random coil, while in the near UV region, small positive peaks were observed. The ellipticity in both regions decreased on raising the temperature. Proton NMR experiments showed the native structure unfolds to unordered conformations at 70 degrees C.(ABSTRACT TRUNCATED AT 250 WORDS)


Assuntos
Proteínas do Ovo/química , Membrana Vitelina/química , Sequência de Aminoácidos , Aminoácidos/análise , Animais , Varredura Diferencial de Calorimetria , Galinhas , Dicroísmo Circular , Dissulfetos/química , Endopeptidases/metabolismo , Ponto Isoelétrico , Espectroscopia de Ressonância Magnética , Dados de Sequência Molecular , Muramidase/química , Muramidase/metabolismo , Conformação Proteica , Estrutura Secundária de Proteína , Análise de Sequência , Homologia de Sequência de Aminoácidos , Termodinâmica , Transferases/metabolismo
SELEÇÃO DE REFERÊNCIAS
Detalhe da pesquisa