Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 32
Filtrar
Más filtros

Banco de datos
País/Región como asunto
Tipo del documento
Intervalo de año de publicación
1.
Clin Microbiol Infect ; 25(5): 629.e7-629.e12, 2019 May.
Artículo en Inglés | MEDLINE | ID: mdl-30145403

RESUMEN

OBJECTIVES: The aim of this study was to determine whether assessment of wound infection differs when culture results from wound biopsy versus wound swab are available in clinical practice. METHODS: For 180 eligible patients, a swab and biopsy were taken from one wound during a regular appointment at a wound care facility in eastern Netherlands. Culture results from both methods were supplemented with clinical information and provided to a panel of six experts who independently assessed each wound as infect or not, separately for swab and biopsy. Assessments for biopsy and swab were compared for the complete expert panel, and for individual experts. RESULTS: The complete expert panel provided the same wound assessment based on (clinical information and) culture results from wound biopsy and wound swab in 158 of 180 wounds (87.8%, kappa 0.67). For individual experts, agreement between biopsy and swab varied between 77% and 96%. However, there were substantial differences between experts: the same assessment was provided in 62 (34.4%) to 76 (42.2%) wounds for swab and biopsy respectively. CONCLUSIONS: Assessment of infection does not significantly differ when culture results from swabs or biopsies are available. The substantial variability between individual experts indicates non-uniformity in the way wounds are assessed. This complicates accurate detection of infection and comparability between studies using assessment of infection as reference standard.


Asunto(s)
Biopsia/métodos , Técnicas Microbiológicas/métodos , Manejo de Especímenes/métodos , Infección de Heridas/diagnóstico , Adulto , Anciano , Anciano de 80 o más Años , Femenino , Humanos , Masculino , Persona de Mediana Edad , Países Bajos , Variaciones Dependientes del Observador , Estudios Prospectivos , Sensibilidad y Especificidad
2.
Neuroscience ; 147(3): 720-6, 2007 Jul 13.
Artículo en Inglés | MEDLINE | ID: mdl-17560042

RESUMEN

Endostatin/collagen XVIII is a specific inhibitor of endothelial proliferation and migration in vitro. It has also been shown to have anti-angiogenic activity and tumor growth inhibitory activity in vivo and in vitro. Here we studied expression of endostatin/collagen XVIII in a rat traumatic brain injury (TBI) model, focusing on the early phase. A significant up-regulation of endostatin/collagen XVIII in TBI began as early as 24 h post-TBI. Double-staining experiment revealed that the major resource of endostatin/collagen XVIII(+) cells in our TBI rat model was a subpopulation of reactivated microglia/macrophages. Our data further showed that dexamethasone attenuated up-regulation of endostatin/collagen XVIII expression at days 1 and 2, but not at day 4, post-TBI, indicating that dexamethasone might possess an early and transient influence to the angiogenesis following TBI.


Asunto(s)
Antiinflamatorios/administración & dosificación , Lesiones Encefálicas/tratamiento farmacológico , Colágeno/metabolismo , Dexametasona/administración & dosificación , Endostatinas/metabolismo , Regulación hacia Arriba/efectos de los fármacos , Animales , Lesiones Encefálicas/metabolismo , Recuento de Células , Masculino , Ratas , Ratas Endogámicas Lew , Factores de Tiempo
3.
Neuroscience ; 141(2): 637-644, 2006 Aug 25.
Artículo en Inglés | MEDLINE | ID: mdl-16725271

RESUMEN

Local inflammatory responses play an important role in mediating secondary tissue damage in traumatic brain injury. Characterization of leukocytic subpopulations contributing to the early infiltration of the damaged tissue might aid in further understanding of lesion development and contribute to definition of cellular targets for selective immunotherapy. In a rat traumatic brain injury model, significant CD8+ cell accumulation was observed 3 days post-injury. The CD8+ cells were strictly distributed to the pannecrotic areas and around the pannecrotic perimeter. The morphology, time course of accumulation and distribution of CD8+ cells were similar to that of reactive ED1+ and endothelial monocyte-activating polypeptide II+ microglia/macrophages, but different from W3/13+ T cells. Further double-labeling experiments confirmed that the major cellular sources of CD8 were reactive macrophages/microglia. Both the location of these CD8+ macrophages/microglia to the border of the pannecrosis and their co-expression of endothelial monocyte-activating polypeptide II and P2X4 receptor suggest they might have a central role in lesion development and might thus be candidates for development of immunotherapeutic, anti-inflammatory strategies.


Asunto(s)
Lesiones Encefálicas/inmunología , Antígenos CD8/inmunología , Macrófagos/metabolismo , Microglía/metabolismo , Animales , Lesiones Encefálicas/complicaciones , Lesiones Encefálicas/metabolismo , Lesiones Encefálicas/patología , Antígenos CD8/metabolismo , Linfocitos T CD8-positivos/fisiología , Recuento de Células/métodos , Citocinas/metabolismo , Ectodisplasinas , Inmunohistoquímica/métodos , Inflamación/etiología , Activación de Macrófagos , Macrófagos/inmunología , Proteínas de la Membrana/metabolismo , Microglía/inmunología , Proteínas de Neoplasias/metabolismo , Proteínas de Unión al ARN/metabolismo , Ratas , Ratas Endogámicas Lew , Receptores Purinérgicos P2/metabolismo , Receptores Purinérgicos P2X4 , Factores de Tiempo , Factores de Necrosis Tumoral/metabolismo
4.
Neuroscience ; 138(1): 47-53, 2006.
Artículo en Inglés | MEDLINE | ID: mdl-16388909

RESUMEN

We have analyzed early expression of bone morphogenetic protein-6 in rat brains subjected to traumatic brain injury. Bone morphogenetic protein-6 was expressed in neurons of the hippocampus and cortex in normal adult rat brains. A pronounced expression of bone morphogenetic protein-6 in astroglia located to the lesion became obvious 48 h postinjury. Bone morphogenetic protein-6(+) glia were distributed around the lesion, thus demarcating the injured tissue from normal brain. Double labeling by immunohistochemistry revealed that the major glial sources for bone morphogenetic protein-6 were reactive astrocytes and few ED1(+) or W3/13(+) cells co-expressed bone morphogenetic protein-6. Furthermore, bone morphogenetic protein-6 expression in neurons located to hippocampus and cortex of the lesioned hemisphere was up-regulated 3 days postinjury. In conclusion, this is the first description of bone morphogenetic protein-6 expression in traumatic brains. Our data suggest that bone morphogenetic protein-6 might be involved in astrogliosis and neuron protection following traumatic brain injury.


Asunto(s)
Astrocitos/metabolismo , Proteínas Morfogenéticas Óseas/biosíntesis , Lesiones Encefálicas/metabolismo , Animales , Proteína Morfogenética Ósea 6 , Corteza Cerebral/citología , Corteza Cerebral/metabolismo , Gliosis/patología , Hipocampo/citología , Hipocampo/metabolismo , Inmunohistoquímica , Ratas , Ratas Endogámicas Lew , Factores de Tiempo , Regulación hacia Arriba/fisiología
5.
Plant Physiol ; 108(2): 581-588, 1995 Jun.
Artículo en Inglés | MEDLINE | ID: mdl-12228495

RESUMEN

The osmoprotectant glycine betaine is synthesized via the path-way choline -> betaine aldehyde -> glycine betaine. In spinach (Spinacia oleracea), the first step is catalyzed by choline monooxygenase (CMO), and the second is catalyzed by betaine aldehyde dehydrogenase. Because betaine aldehyde is unstable and not easily detected, we developed a coupled radiometric assay for CMO. [14C]Choline is used as substrate; NAD+ and betaine aldehyde dehydrogenase prepared from Escherichia coli are added to oxidize [14C]betaine aldehyde to [14C]glycine betaine, which is isolated by ion exchange. The assay was used in the purification of CMO from leaves of salinized spinach. The 10-step procedure included polyethylene glycol precipitation, polyethyleneimine precipitation, hydrophobic interaction, anion exchange on choline-Sepharose, dimethyldiethanolamine-Sepharose, and Mono Q, hydroxyapatite, gel filtration, and sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Following gel filtration, overall purification was about 600-fold and recovery of activity was 0.5%. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis showed a polypeptide with a molecular mass of 45 kD. Taken with the value of 98 kD estimated for native CMO (R. Brouquisse, P. Weigel, D. Rhodes, C.F. Yocum, A.D. Hanson [1989] Plant Physiol 90: 322-329), this indicates that CMO is a homodimer. CMO preparations were red-brown, showed absorption maxima at 329 and 459 nm, and lost color upon dithionite addition, suggesting that CMO is an iron-sulfur protein.

6.
Gene ; 244(1-2): 151-61, 2000 Feb 22.
Artículo en Inglés | MEDLINE | ID: mdl-10689197

RESUMEN

Stachydrine (proline betaine) can be used by Sinorhizobium meliloti as a source of carbon and nitrogen. Catabolism depends on an initial N-demethylation, after which the resultant N-methyl proline enters general metabolism. Deletion and insertion mutagenesis demonstrated that the information necessary for catabolism is carried on the symbiotic plasmid (pSym) distal to nodD2 and the nod-nif cluster. Sequencing of an 8.5kb fragment spanning this region revealed four open reading frames with functional homology to known proteins, including a putative monooxygenase and a putative NADPH-FMN-reductase, which were shown by insertional and frame-shift mutagenesis to be necessary for stachydrine catabolism. Other open reading frames, encoding a putative flavoprotein and a repressor, were judged not to be required for stachydrine catabolism, since they were not included in a fragment capable of complementing a deletion of the entire stc region. Sequence and mutagenesis data suggest that stachydrine is demethylated by an iron-sulfur monooxygenase of the Rieske type with a requirement for a specific reductase. The stc catabolic cluster, therefore, resembles xenobiotic degradation in other bacteria and recalls rhizopine catabolism in S. meliloti. Stachydrine appears to have multiple roles in osmoprotection, nutrition and nodulation. Genes involved in stachydrine catabolism are also necessary for carnitine degradation; thus, they could be important in the catabolism of a variety of root exudates and mediate other relationships.


Asunto(s)
Bacterias/metabolismo , Complejos Multienzimáticos/genética , Prolina/análogos & derivados , Sinorhizobium meliloti/metabolismo , Xenobióticos/metabolismo , Secuencia de Aminoácidos , Biodegradación Ambiental , Radioisótopos de Carbono , Carnitina/metabolismo , ADN Bacteriano/genética , Flavoproteínas/genética , Prueba de Complementación Genética , Datos de Secuencia Molecular , Complejos Multienzimáticos/metabolismo , Mutagénesis Insercional , Fijación del Nitrógeno/genética , Sistemas de Lectura Abierta , Oxidorreductasas/genética , Oxigenasas/genética , Raíces de Plantas/microbiología , Plásmidos/genética , Prolina/metabolismo , Proteínas Represoras/genética , Alineación de Secuencia , Análisis de Secuencia de ADN , Homología de Secuencia de Aminoácido , Sinorhizobium meliloti/enzimología , Sinorhizobium meliloti/genética , Simbiosis
7.
Insect Biochem Mol Biol ; 28(4): 251-8, 1998 Apr.
Artículo en Inglés | MEDLINE | ID: mdl-9684333

RESUMEN

Sex pheromone biosynthesis in a number of moth species is induced by a conserved 33-amino acid amidated neuropeptide PBAN (pheromone biosynthesis activating neuropeptide). Here, using immunoblotting and bioassay, we present evidence for the presence of a very similar peptide, called Mab-PBAN, in the brain-subesophageal ganglion complex of Mamestra brassicae females. A partial Mab-PBAN encoding cDNA was isolated using 3'RACE. The deduced amino acid sequence for Mab-PBAN is: LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL with a presumed amidated C-terminus. Mab-PBAN has high homology to the other members of the PBAN peptide family: 94% with Hez-PBAN, 87.9% with Lyd-PBAN and 78.8% with Bom-PBAN. The Mab-PBAN gene encodes, beside Mab-PBAN, at least three putative amidated peptides in the same reading frame, all of them having a common C-terminal pentapeptide motif F(T/S)P(R/K)L-NH2.


Asunto(s)
Clonación Molecular , ADN Complementario/análisis , Mariposas Nocturnas/genética , Neuropéptidos/genética , Homología de Secuencia de Aminoácido , Atractivos Sexuales/genética , Secuencia de Aminoácidos , Animales , Química Encefálica , Datos de Secuencia Molecular , Análisis de Secuencia de ADN
8.
Curr Med Res Opin ; 10(7): 441-9, 1987.
Artículo en Inglés | MEDLINE | ID: mdl-3621989

RESUMEN

A study was carried out in 16 patients with moderately severe hypertension to investigate the effects of nifedipine, given alone or combined with a diuretic, on blood pressure and on renal and platelet function. After 4 weeks on placebo, patients were randomized to receive treatment for 6 weeks with either 20 mg, nifedipine twice daily or 25 mg mefruside once daily on a double-blind, double-dummy basis. All patients then received treatment for a further 6 weeks with a combination of the two drugs in the same dosage as before. The results of blood pressure measurements and laboratory investigations during the three phases of the study showed that significantly better blood pressure control was achieved with nifedipine alone than with mefruside alone. Mefruside had an additional hypotensive effect when added to nifedipine. There was no significant change in the renal blood flow or glomerular filtration rate, with a satisfactory control of blood pressure. There was also no detectable change in platelet aggregation with increasing concentrations of ADP and ristocetin. An adaptive mechanism could be responsible for the apparent lack of change compared with single dose studies.


Asunto(s)
Diuréticos/uso terapéutico , Hipertensión/tratamiento farmacológico , Riñón/efectos de los fármacos , Mefrusida/uso terapéutico , Nifedipino/uso terapéutico , Agregación Plaquetaria/efectos de los fármacos , Presión Sanguínea/efectos de los fármacos , Quimioterapia Combinada , Femenino , Tasa de Filtración Glomerular/efectos de los fármacos , Humanos , Masculino , Persona de Mediana Edad , Distribución Aleatoria , Circulación Renal/efectos de los fármacos
9.
Br J Pharmacol ; 171(7): 1783-94, 2014 Apr.
Artículo en Inglés | MEDLINE | ID: mdl-24417187

RESUMEN

BACKGROUND AND PURPOSE: Azithromycin is a macrolide antibiotic with anti-inflammatory and immunomodulating effects. Long-term azithromycin therapy in patients with chronic lung diseases such as cystic fibrosis has been associated with increased antimicrobial resistance, emergence of hypermutable strains, ototoxicity and cardiac toxicity. The aim of this study was to assess the anti-inflammatory effects of the non-antibiotic azithromycin derivative CSY0073. EXPERIMENTAL APPROACH: We compared the effects of CSY0073 with those of azithromycin in experiments on bacterial cultures, Pseudomonas aeruginosa biofilm, lung cells and mice challenged intranasally with P. aeruginosa LPS. KEY RESULTS: In contrast to azithromycin, CSY0073 did not inhibit the growth of P. aeruginosa, Staphylococcus aureus or Haemophilus influenzae and had no effect on an established P. aeruginosa biofilm. Bronchoalveolar lavage (BAL) fluids and lung homogenates collected after the LPS challenge in mice showed that CSY0073 and azithromycin (200 mg·kg(-1), i.p.) decreased neutrophil counts at 24 h and TNF-α, CXCL1 and CXCL2 levels in the BAL fluid after 3 h and IL-6, CXCL2 and IL-1ß levels in the lung after 3 h compared with the vehicle. However, only azithromycin reduced IL-1ß levels in the lung 24 h post LPS challenge. CSY0073 and azithromycin similarly diminished the production of pro-inflammatory cytokines by macrophages, but not lung epithelial cells, exposed to P. aeruginosa LPS. CONCLUSIONS AND IMPLICATIONS: Unlike azithromycin, CSY0073 had no antibacterial effects but it did have a similar anti-inflammatory profile to that of azithromycin. Hence, CSY0073 may have potential as a long-term treatment for patients with chronic lung diseases.


Asunto(s)
Antiinflamatorios/farmacología , Azitromicina/análogos & derivados , Lipopolisacáridos , Pulmón/efectos de los fármacos , Neumonía/prevención & control , Animales , Azitromicina/farmacología , Biopelículas/efectos de los fármacos , Biopelículas/crecimiento & desarrollo , Líquido del Lavado Bronquioalveolar/inmunología , Modelos Animales de Enfermedad , Relación Dosis-Respuesta a Droga , Mediadores de Inflamación/metabolismo , Pulmón/inmunología , Ratones , Ratones Endogámicos C57BL , Neumonía/inducido químicamente , Neumonía/inmunología , Pseudomonas aeruginosa/efectos de los fármacos , Pseudomonas aeruginosa/crecimiento & desarrollo , Factores de Tiempo
12.
Aust Vet J ; 52(10): 479-81, 1976 Oct.
Artículo en Inglés | MEDLINE | ID: mdl-1016141
13.
Aust Nurses J ; 1(12): 34-8, 1972 Jun.
Artículo en Inglés | MEDLINE | ID: mdl-4483689
14.
Artif Organs ; 9(1): 61-3, 1985 Feb.
Artículo en Inglés | MEDLINE | ID: mdl-3888153

RESUMEN

The antiplatelet drug ticlopidine was assessed as an agent for improving the patency of Brescia-Cimino arteriovenous fistulas as access for hemodialysis. In a double-blind randomized study over 1 month, two of six fistulas in the ticlopidine group and five of nine in the placebo group failed. A further one placebo and two ticlopidine patients still had functioning fistulas at the time of withdrawal for technical reasons from the trial. Ticlopidine appears, therefore, to enhance the efficacy of Brescia-Cimino fistulas, at least in the short term.


Asunto(s)
Anticoagulantes/uso terapéutico , Derivación Arteriovenosa Quirúrgica , Oclusión de Injerto Vascular/prevención & control , Diálisis Renal/métodos , Tiofenos/uso terapéutico , Ensayos Clínicos como Asunto , Método Doble Ciego , Humanos , Trombosis/prevención & control , Ticlopidina
15.
Am J Physiol ; 276(6): H2194-203, 1999 06.
Artículo en Inglés | MEDLINE | ID: mdl-10362704

RESUMEN

We have measured plasma volume expansion (Evans blue and hematocrit changes) and hemodynamic responses in conscious hemorrhaged and normovolemic splenectomized sheep after a 30-min infusion of either 20 ml/kg of diaspirin cross-linked hemoglobin (DCLHb), 20 ml/kg of human albumin (Alb), or 60 ml/kg of a solution of Ringer lactate (RL). All regimens expanded blood volume and increased blood pressure and cardiac output after hemorrhage. However, only 15 +/- 3% of the infused volume of RL was evident as intravascular expansion 10-min postinfusion, compared with 67 +/- 16% and 139 +/- 139% for Alb and DCLHb, respectively. DCLHb infusions were associated with higher blood pressures and lower cardiac outputs compared with RL and Alb infusions, but the increased oxygen content of blood with DCLHb resulted in systemic delivery of oxygen similar to that of the other infusions. These differences in hemodynamics and vascular volume continued for 6 h, and at 24 h vascular volume and all hemodynamics were similar in all three groups. The better volume expansion with DCLHb may be due to greater mobilization of endogenous interstitial protein or reduced transcapillary loss as total intravascular endogenous plasma protein increased after infusion of DCLHb, whereas there was an apparent loss of endogenous intravascular protein after infusions of Alb and RL. Vasoconstriction by DCLHb is one mechanism that could lower blood-to-tissue transport of fluid and protein. In addition to its oxygen-carrying capacity and vasoactivity, DCLHb is associated with volume expansion properties out of proportion to its colloid osmotic pressure.


Asunto(s)
Hemoglobinas/farmacología , Soluciones Isotónicas/farmacología , Sustitutos del Plasma/farmacología , Volumen Plasmático/efectos de los fármacos , Albúmina Sérica/farmacología , Animales , Aspirina/análogos & derivados , Aspirina/farmacología , Femenino , Hemorragia/fisiopatología , Valores de Referencia , Lactato de Ringer , Ovinos , Soluciones , Esplenectomía
16.
Proc Natl Acad Sci U S A ; 91(1): 306-10, 1994 Jan 04.
Artículo en Inglés | MEDLINE | ID: mdl-8278383

RESUMEN

In common with other zwitterionic quarternary ammonium compounds (QACs), glycine betaine acts as an osmoprotectant in plants, bacteria, and animals, with its accumulation in the cytoplasm reducing adverse effects of salinity and drought. For this reason, the glycine betaine biosynthesis pathway has become a target for genetic engineering of stress tolerance in crop plants. Besides glycine betaine, several other QAC osmoprotectants have been reported to accumulate among flowering plants, although little is known about their distribution, evolution, or adaptive value. We show here that various taxa of the highly stress-tolerant family Plumbaginaceae have evolved four QACs, which supplement or replace glycine betaine-namely, choline O-sulfate and the betaines of beta-alanine, proline, and hydroxyproline. Evidence from bacterial bioassays demonstrates that these QACs function no better than glycine betaine as osmoprotectants. However, the distribution of QACs among diverse members of the Plumbaginaceae adapted to different types of habitat indicates that different QACs could have selective advantages in particular stress environments. Specifically, choline O-sulfate can function in sulfate detoxification as well as in osmoprotection, beta-alanine betaine may be superior to glycine betaine in hypoxic saline conditions, and proline-derived betaines may be beneficial in chronically dry environments. We conclude that the evolution of osmoprotectant diversity within the Plumbaginaceae suggests additional possibilities to explore in the metabolic engineering of stress tolerance in crops.


Asunto(s)
Betaína , Fenómenos Fisiológicos de las Plantas , Equilibrio Hidroelectrolítico , Aldehído Oxidorreductasas/metabolismo , Betaína/análogos & derivados , Betaína/farmacología , Betaína Aldehído Deshidrogenasa , Western Blotting , Escherichia coli/efectos de los fármacos , Espectrometría de Masas , Prolina/análogos & derivados , Prolina/química , Prolina/farmacología , Salmonella typhimurium/efectos de los fármacos
17.
Proc Natl Acad Sci U S A ; 94(7): 3454-8, 1997 Apr 01.
Artículo en Inglés | MEDLINE | ID: mdl-9096415

RESUMEN

Plants synthesize the osmoprotectant glycine betaine via the route choline --> betaine aldehyde --> glycine betaine. In spinach, the first step is catalyzed by choline monooxygenase (CMO), a ferredoxin-dependent stromal enzyme that has been hypothesized to be an oligomer of identical subunits and to be an Fe-S protein. Analysis by HPLC and matrix-assisted laser desorption ionization MS confirmed that native CMO contains only one type of subunit (Mr 42,864). Determination of acid-labile sulfur and nonheme iron demonstrated that there is one [2Fe-2S] cluster per subunit, and EPR spectral data indicated that this cluster is of the Rieske type--i.e., coordinated by two Cys and two His ligands. A full-length CMO cDNA (1,622 bp) was cloned from spinach using a probe generated by PCR amplification for which the primers were based on internal peptide sequences. The ORF encoded a 440-amino acid polypeptide that included a 60-residue transit peptide. The deduced amino acid sequence included two Cys-His pairs spaced 16 residues apart, a motif characteristic of Rieske-type Fe-S proteins. Larger regions that included this motif also showed some sequence similarity (approximately 40%) to Rieske-type proteins, particularly bacterial oxygenases. Otherwise there was very little similarity between CMO and proteins from plants or other organisms. RNA and immunoblot analyses showed that the expression of CMO in leaves increased several-fold during salinization. We conclude that CMO is a stress-inducible representative of a new class of plant oxygenases.


Asunto(s)
Betaína/metabolismo , Proteínas Hierro-Azufre/metabolismo , Oxigenasas/metabolismo , Plantas/metabolismo , Secuencia de Aminoácidos , Secuencia de Bases , Catálisis , Clonación Molecular , ADN Complementario , Espectroscopía de Resonancia por Spin del Electrón , Proteínas Hierro-Azufre/genética , Datos de Secuencia Molecular , Oxigenasas/genética
18.
Astrophys J ; 532(1): L55-L58, 2000 Mar 20.
Artículo en Inglés | MEDLINE | ID: mdl-10702131

RESUMEN

We report a spectroscopic orbit with period P=3.52433+/-0.00027 days for the planetary companion that transits the solar-type star HD 209458. For the metallicity, mass, and radius of the star, we derive [Fe/H&sqbr0;=0.00+/-0.02, M*=1.1+/-0.1 M middle dot in circle, and R*=1.2+/-0.1 R middle dot in circle. This is based on a new analysis of the iron lines in our HIRES template spectrum and also on the absolute magnitude, effective temperature, and color of the star, and it uses isochrones from four different sets of stellar evolution models. Using these values for the stellar parameters, we reanalyze the transit data and derive an orbital inclination of i=86&fdg;1+/-1&fdg;6. For the planet, we derive a mass of Mp=0.69+/-0.05 MJup, a radius of Rp=1.40+/-0.17 RJup, and a density of rho=0.31+/-0.07 g cm-3.

19.
Med J Aust ; 143(4): 138, 1985 Aug 19.
Artículo en Inglés | MEDLINE | ID: mdl-4021906
SELECCIÓN DE REFERENCIAS
DETALLE DE LA BÚSQUEDA