RESUMO
Inflammatory bowel diseases (IBD) are chronic, recurring gastrointestinal diseases that severely impair health and quality of life. Although therapeutic options have significantly expanded in recent years, there is no effective therapy for a complete and permanent cure for IBD. Well tolerated dietary interventions to improve gastrointestinal health in IBD would be a welcome advance especially with anticipated favorable tolerability and affordability. Soluble protein hydrolysate (SPH) is produced by the enzymatic hydrolysis of commercial food industry salmon offcuts (consisting of the head, backbone and skin) and contains a multitude of bioactive peptides including those with anti-oxidant properties. This study aimed to investigate whether SPH ameliorates gastrointestinal injury in 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced mouse colitis model. Mice were randomly assigned to four groups: Control (no colitis), Colitis, Colitis/CP (with control peptide treatment), and Colitis/SPH (with SPH treatment). Colitis was induced by cutaneous sensitization with 1% TNBS on day -8 followed by 2.5% TNBS enema challenge on day 0. Control peptides and SPH were provided to the mice in the Colitis/CP or Colitis/SPH group respectively by drinking water at the final concentration of 2% w/v daily from day -10 to day 4. Then, the colon was harvested on day 4 and examined macro- and microscopically. Relevant measures included disease activity index (DAI), colon histology injury, immune cells infiltration, pro- and anti-inflammatory cytokines and anti-oxidative gene expression. It was found that SPH treatment decreased the DAI score and colon tissue injury when compared to the colitis-only and CP groups. The protective mechanisms of SPH were associated with reduced infiltration of CD4+ T, CD8+ T and B220+ B lymphocytes but not macrophages, downregulated pro-inflammatory cytokines (tumor necrosis factor-α and interleukin-6), and upregulated anti-inflammatory cytokines (transforming growth factor-ß1 and interleukin-10) in the colon tissue. Moreover, the upregulation of anti-oxidative genes, including ferritin heavy chain 1, heme oxygenase 1, NAD(P)H quinone oxidoreductase 1, and superoxide dismutase 1, in the colons of colitis/SPH group was observed compared with the control peptide treatment group. In conclusion, the protective mechanism of SPH is associated with anti-inflammatory and anti-oxidative effects as demonstrated herein in an established mice model of colitis. Clinical studies with SPH as a potential functional food for the prevention or as an adjuvant therapy in IBD may add an effective and targeted diet-based approach to IBD management in the future.
Assuntos
Colite , Água Potável , Doenças Inflamatórias Intestinais , Animais , Anti-Inflamatórios/uso terapêutico , Antioxidantes/uso terapêutico , Apoferritinas , Colite/induzido quimicamente , Colite/tratamento farmacológico , Colite/patologia , Citocinas/metabolismo , Água Potável/efeitos adversos , Heme Oxigenase-1/metabolismo , Inflamação/tratamento farmacológico , Doenças Inflamatórias Intestinais/metabolismo , Interleucina-10/metabolismo , Interleucina-6/metabolismo , Camundongos , NAD/metabolismo , Hidrolisados de Proteína/metabolismo , Qualidade de Vida , Quinonas/uso terapêutico , Superóxido Dismutase-1/metabolismo , Fator de Crescimento Transformador beta1/metabolismo , Trinitrobenzenos , Ácido Trinitrobenzenossulfônico/efeitos adversos , Fator de Necrose Tumoral alfa/metabolismoRESUMO
The development of optical organic nanoparticles (NPs) is desirable and widely studied. However, most organic dyes are water-insoluble such that the derivatization and modification of these dyes are difficult. Herein, we demonstrated a simple platform for the fabrication of organic NPs designed with emissive properties by loading ten different organic dyes (molar masses of 479.1-1081.7 g/mol) into water-soluble polymer nanosponges composed of poly(styrene-alt-maleic acid) (PSMA). The result showed a substantial improvement over the loading of commercial dyes (3.7-50% loading) while preventing their spontaneous aggregation in aqueous solutions. This packaging strategy includes our newly synthesized organic dyes (> 85% loading) designed for OPVs (242), DSSCs (YI-1, YI-3, YI-8), and OLEDs (ADF-1-3, and DTDPTID) applications. These low-cytotoxicity organic NPs exhibited tunable fluorescence from visible to near-infrared (NIR) emission for cellular imaging and biological tracking in vivo. Moreover, PSMA NPs loaded with designed NIR-dyes were fabricated, and photodynamic therapy with these dye-loaded PSMA NPs for the photolysis of cancer cells was achieved when coupled with 808 nm laser excitation. Indeed, our work demonstrates a facile approach for increasing the biocompatibility and stability of organic dyes by loading them into water-soluble polymer-based carriers, providing a new perspective of organic optoelectronic materials in biomedical theranostic applications.
Assuntos
Nanopartículas , Fotoquimioterapia , Corantes , Polímeros , ÁguaRESUMO
A rapid and highly sensitive paper-based colorimetric device for the on-site detection of ammonia (NH3) gas is presented in this study. The detection principle of this device is based upon a change of color from red to yellow on a paper that has been immobilized with a pH indicator, i.e., methyl orange (pKa = 3.4), in the presence of NH3 gas. The color signal of the device can be measured through the hue channel of an HSL system via the application of a smartphone. This device can detect the amount of NH3 gas within 3 min. The linear relationship between the NH3 gas concentration and the hue signal was found to be in the range from 6.0 to 54.0 ppbv with R2 = 0.9971, and the limit of detection was found to be 2.0 ppbv. In addition, this device showed remarkably high selectivity to NH3 gas amongst the other common volatile organic compounds and general gases that are present in environmental air without the assistance of any membrane material. Furthermore, we demonstrated the applicability of this device for the detection of total NH3 gas at a chicken farm and in a laboratory, with relative standard deviations of 6.2% and 5.4%, respectively. The developed NH3 gas device in the study is easy to operate and cost-effective, with the reduction of a large consumption of chemical reagents; also, its signals can be measured simply and then recorded through a smartphone. It is suitable for the application of routine on-site detection of NH3 gas, especially concerning regions which have limited resources.
RESUMO
Retinal arterial macroaneurysms (RAMs) develop as outpouchings of the arterial wall that is weakened by arteriosclerosis. The traditional treatment of RAMs comprises observation, focal laser photocoagulation, or surgery. Recently, intravitreal injection of anti-vascular endothelial growth factor (VEGF) drugs has been announced as an effective therapy for fovea-threatening RAMs and quickly improve visual acuity and central retinal thickness (CRT).In the retrospective series, medical charts and ocular images of 24 patients diagnosed as having RAM between May 2011 and November 2018 in our facility were reviewed to delineate clinical manifestations and visual prognosis in RAM patients receiving different treatment modalities. Twenty-four patients (25 eyes; 11 men and 13 women) were enrolled, and one eye with comorbidity of branch retinal vein occlusion was excluded. The mean age of the patients was 69.00â±â13.45 years. Fourteen patients (58.33%) had a history of hypertension, and 17 patients (70.83%) were aged >â60 years. Furthermore, patients with fovea-threatening RAMs presented with either hypertension or were aged >â60 years.Eyes with fovea involvement (nâ=â18) were analyzed and separated into two groups according to their treatment modalities: those receiving anti-VEGF intravitreal injections (nâ=â13) and observation only (nâ=â5). The baseline visual acuity revealed no significant difference in the two groups. In patients receiving anti-VEGF intravitreal injections, a significantly better visual acuity was detected after anti-VEGF intravitreal injections than the baseline visual acuity (logMAR, 0.78â±â0.51 vs 1.52â±â0.48, Pâ<â.001), and CRT significantly improved (505.50â±â159.26âµm vs 243.60â±â60.17âµm, Pâ=â.001). Patients receiving anti-VEGF intravitreal injections also revealed better final visual acuity than those in the observation group (logMAR, 0.78â±â0.51 vs 1.34â±â0.48, Pâ=â.04).A systematic work-up for hypertension and arteriosclerotic disease could be considered the recommended procedure once RAM has been diagnosed. With better final visual acuity, significant visual improvements, and fast reduction of CRT observed in patients with fovea-threatening RAMs receiving anti-VEGF intravitreal injections, intravitreal anti-VEGF was considered an effective therapy for complicated RAM. During the follow-up period, the majority of RAM eyes had good maintenance of visual function even with foveal complications.
Assuntos
Inibidores da Angiogênese/uso terapêutico , Bevacizumab/uso terapêutico , Tomada de Decisões , Macroaneurisma Arterial Retiniano/tratamento farmacológico , Idoso , Feminino , Humanos , Injeções Intravítreas , Masculino , Pessoa de Meia-Idade , Prognóstico , Estudos Retrospectivos , Acuidade VisualRESUMO
PURPOSE: To investigate the risk factors associated with corneal epithelial defects (CED) and delayed healing (exceeding 1 week) following pars plana vitrectomy (PPV). METHODS: This retrospective study enrolled patients who underwent PPV at a single center in Taiwan between 2011 and 2012. Medical records were reviewed, including demographic, underlying disease, surgical indication, operation parameters, and existence of CED. These data were statistically analyzed. All patients were evaluated during follow-ups at day 1 and week 1 after PPV. Patients with persistent CED 1 week after PPV were diagnosed with delayed healing. RESULTS: A total of 255 patients were included in the study, consisting of 139 men and 116 women, with a mean age of 56.9 years. PPV was performed under the indications of rhegmatogenous retinal detachment (RRD), diabetic retinopathy, or vitreoretinal interface disease. Out of 255 eyes, 59 developed CED 1 day after surgery (23.1%), and CED was associated with younger age, diabetes mellitus (DM), RRD, longer duration of surgery, and silicon oil use during surgery. Among them, seven patients (11.9%) demonstrated delayed healing, which was associated with a higher rate of DM (p = 0.085), compared to patients who healed within 1 week. CONCLUSION: Patients with RRD, longer duration of surgery, and DM may be at risk of developing CED after PPV. In addition, patients with DM demonstrated a higher incidence of delayed corneal healing.
Assuntos
Doenças da Córnea/etiologia , Epitélio Corneano/patologia , Complicações Pós-Operatórias/etiologia , Vitrectomia/efeitos adversos , Adulto , Fatores Etários , Idoso , Complicações do Diabetes , Feminino , Humanos , Tempo de Internação , Masculino , Pessoa de Meia-Idade , Estudos Retrospectivos , Fatores de Risco , Óleos de Silicone/administração & dosagem , CicatrizaçãoRESUMO
PURPOSE: We report a case of rapid cataract progression after Nd:YAG vitreolysis for vitreous floaters. CASE REPORT: A 55-year-old man presented with acute onset of blurred vision following Nd:YAG vitreolysis for symptomatic floaters in the left eye. His initial best corrected visual acuity (BCVA) was 20/1,000 in the left eye. Ocular examinations showed frost-like opacities of the lens and a suspected break of the posterior capsule in the left eye. There were no detectable retinal lesions. Cataract surgery was then arranged. Posterior capsular rupture and vitreous loss occurred during surgery, which required a subsequent pars plana vitrectomy. After the surgery, BCVA in the left eye gradually improved to 20/20 and was maintained during a 1-year follow-up period. CONCLUSION: Crystalline lens injuries and rapid cataract progression may occur following Nd:YAG vitreolysis. While dealing with this type of complicated cataract, clinicians should be aware of the possibility of posterior lens capsule rupture during surgery and the need for combined vitrectomy.
RESUMO
PURPOSE: Basketball is a popular sport involving significant body contact, which may frequently result in ocular trauma. The aim of this study was to evaluate the characteristics and visual outcomes of retinal detachment associated with basketball-related injury. DESIGN: Retrospective, interventional case series. METHODS: We reviewed the course of patients who sustained traumatic retinal detachment from basketball-related ocular trauma between 2003 and 2015. RESULTS: Thirteen patients were evaluated for basketball-related traumatic retinal detachment. Twelve (92%) were male and 1 (8%) female, with an average age of 18.2 years. The majority (9 of 13, 70%) of patients had moderate-to-high myopia, and none were using protective eyewear when they sustained the eye trauma. Rhegmatogenous retinal detachment was observed in all eyes. The preoperative mean visual acuity was 20/625 (range, hand motions to 20/20). Initial surgery using scleral buckling alone was performed in most (8 of 13, 62%) of the patients. Retinal reattachment was achieved in 10 (76%) eyes after the first operation and in 12 (92%) at the end of the intervention. The mean follow-up was 3.9 years (range, 4 months to 12 years). The visual acuity during last follow-up was 20/231 (range, light perception to 20/20). In the multivariable analysis, initial visual acuity was an independent factor affecting the final visual outcome (P = .006). CONCLUSION: Retinal detachment associated with basketball-related injury may cause severe visual loss. In the current study, all retinal detachments were of rhegmatogenous type and commonly occurred in young individuals with myopia. Initial visual acuity was associated with the prognosis. Risk awareness for early detection and intervention are important in these traumas.
Assuntos
Basquetebol/lesões , Traumatismos Oculares/etiologia , Descolamento Retiniano/etiologia , Perfurações Retinianas/etiologia , Ferimentos não Penetrantes/etiologia , Adolescente , Adulto , Traumatismos Oculares/diagnóstico , Traumatismos Oculares/cirurgia , Dispositivos de Proteção dos Olhos/estatística & dados numéricos , Feminino , Humanos , Masculino , Miopia/complicações , Procedimentos Cirúrgicos Oftalmológicos , Descolamento Retiniano/diagnóstico , Descolamento Retiniano/cirurgia , Perfurações Retinianas/diagnóstico , Perfurações Retinianas/cirurgia , Estudos Retrospectivos , Acuidade Visual/fisiologia , Ferimentos não Penetrantes/diagnóstico , Ferimentos não Penetrantes/cirurgia , Adulto JovemRESUMO
The purpose of this study was to investigate the spectrum of organisms causing endophthalmitis after cataract surgery in a tertiary medical center in Taiwan and the antibiotic susceptibilities. This was a retrospective case series study. Patients with endophthalmitis after cataract surgery from January 2004 to July 2015 were reviewed. The outcome measures included the identification of isolates, antibiotic susceptibilities, and final visual outcomes. Twenty-one organisms were isolated from 19 cases. The most common organisms were Enterococcus in 38.1 %, especially Enterococcus faecalis, followed by Staphylococcus epidermidis in 28.6 % and Staphylococcus aureus in 9.5 %. All of the Gram-positive isolates tested were susceptible to vancomycin (100 %), and ceftazidime and amikacin were susceptible for Gram-negative organisms. The Gram-positive organisms remain to be the predominant cause of postoperative endophthalmitis, and Enterococcus species has had an increasing incidence. Vancomycin is still the most powerful antibiotic for Gram-positive organisms, while ceftazidime and amikacin are effective for Gram-negative bacteria.
Assuntos
Antibacterianos/farmacologia , Bactérias/isolamento & purificação , Extração de Catarata/efeitos adversos , Infecções Oculares Bacterianas/tratamento farmacológico , Previsões , Infecção da Ferida Cirúrgica/tratamento farmacológico , Corpo Vítreo/microbiologia , Bactérias/efeitos dos fármacos , Endoftalmite/tratamento farmacológico , Endoftalmite/microbiologia , Infecções Oculares Bacterianas/microbiologia , Feminino , Humanos , Masculino , Testes de Sensibilidade Microbiana , Estudos Retrospectivos , Infecção da Ferida Cirúrgica/microbiologia , Acuidade VisualRESUMO
PURPOSE: To evaluate a new application of an expanded polytetrafluoroethylene (Gore-Tex) vascular graft for use in macular buckling surgery for treatment of highly myopic eyes. METHODS: The Gore-Tex vascular graft was used as a macular buckling material in eight consecutive cases of myopic macular diseases which included fovea detachment, foveoschisis, or macular hole retinal detachment. RESULTS: Retinal reattachment was achieved in all cases except one which had partial resolution (88%). The postoperative best-corrected visual acuity ranged from 20/2000 to 20/100 depending on the degree preexisting macular degeneration, and significant better than the preoperative best-corrected visual acuity (P = 0.048, paired t-test). During the follow-up period, which ranged from 8 months to 3 years, no eye developed buckle-related complications such as infection or dislocation. CONCLUSION: The initial pilot results from this series using a Gore-Tex graft for macular buckling is promising. Throughout the follow-up period, the Gore-Tex was well tolerated in the highly myopic eyes. Large scale and long-term follow-up is warranted.
Assuntos
Miopia Degenerativa/complicações , Politetrafluoretileno , Refração Ocular , Descolamento Retiniano/cirurgia , Esclera/cirurgia , Idoso , Prótese Vascular , Feminino , Seguimentos , Humanos , Masculino , Pessoa de Meia-Idade , Miopia Degenerativa/cirurgia , Projetos Piloto , Desenho de Prótese , Descolamento Retiniano/diagnóstico , Descolamento Retiniano/etiologia , Estudos Retrospectivos , Recurvamento da Esclera , Fatores de Tempo , Resultado do Tratamento , Acuidade VisualRESUMO
PURPOSE: To evaluate the impact of macular serous retinal detachment (SRD) and its relationship to treatment outcome after primary intravitreal bevacizumab (IVB) injection in patients with branch retinal vein occlusion (BRVO) and macular edema (ME). METHODS: Seventy-three patients with ME secondary to BRVO who received primary IVB (2.5 mg/0.1 mL) were included in this study. The specific ME patterns were investigated using optical coherence tomography (OCT) examination. Visual acuity (VA), central macular thickness (CMT), and macular volume at baseline; at 1, 3, and 6 months; and at final visit after primary IVB were retrospectively analyzed and compared between patients with and without SRD. RESULTS: SRD was found in 25 patients (34.2%). The baseline CMT was significantly thicker in patients with SRD than in those without it (648.4±200.5 µm vs. 440.3±119.6 µm, P<0.001). Six months after primary IVB injection, a greater reduction in CMT change from baseline was observed in the SRD group (412.5±227.2 µm) than in the group without SRD (118.5±175.2 µm) (P<0.001). The improvement of logarithm of the minimum angle of resolution VA was also greater in the SRD group than in the group without SRD (-0.64±0.52 and -0.28±0.62 respectively, P=0.015). Logistic regression analysis showed that the presence of SRD was an independent factor for visual improvement in BRVO (P=0.027). CONCLUSION: Patients with SRD had greater functional and morphological improvements at 6 months after primary IVB therapy. The results of this study suggest that the presence of SRD observed on OCT may be an indicator of favorable clinical response after IVB injections and that in BRVO patients with SRD, bevacizumab may be a good alternative for treatment.
Assuntos
Anticorpos Monoclonais Humanizados/uso terapêutico , Edema Macular/tratamento farmacológico , Descolamento Retiniano/patologia , Oclusão da Veia Retiniana/complicações , Idoso , Inibidores da Angiogênese/administração & dosagem , Inibidores da Angiogênese/uso terapêutico , Anticorpos Monoclonais Humanizados/administração & dosagem , Bevacizumab , Feminino , Seguimentos , Humanos , Injeções Intravítreas , Modelos Logísticos , Edema Macular/etiologia , Masculino , Pessoa de Meia-Idade , Oclusão da Veia Retiniana/patologia , Estudos Retrospectivos , Tomografia de Coerência Óptica , Resultado do Tratamento , Acuidade VisualRESUMO
PURPOSE: High-mobility group box 1 protein (HMGB1) has been reported to be a potent proangiogenic factor induced by inflammatory stress. In this study, we explore the role of HMGB1 in advanced glycation end products (AGEs)-induced vascular endothelial growth factor A (VEGF-A) production in rat retinal ganglion cell line 5 (RGC-5) cells. METHODS: The VEGF-A protein and mRNA levels in conditioned medium of RGC-5 cells incubated with AGE-modified BSA (AGE-BSA) were examined with real-time PCR and enzyme-linked immunosorbent assay (ELISA), and BSA-treated cells were used as controls. The expression of HMGB1, c-Jun N-terminal kinase (JNK), extracellular-signal-regulated kinase (ERK), and p38 mitogen-activated protein kinase (p38 MAPK) was assessed with immunofluorescence and western blot analysis. Reactive oxidative species (ROS) were detected with flow cytometry measurements of peroxide-dependent oxidation of 2'-7'-dichlorofluorescein-diacetate (DCFH-DA). N-Acetyl-L-cysteine (NAC), glycyrrhizin (GZ), and SP600125 were used to block ROS, HMGB1, and JNK, respectively. RESULTS: Compared with the BSA controls, the RGC-5 cells incubated with AGE-BSA showed a dose- and time-dependent increase in VEGF-A mRNA and VEGF-A protein secretion in the supernatant, with the highest levels achieved at 24 h. AGE-BSA stimulated a significant release of HMGB1 in the supernatant and a significant increase of intracellular ROS production at 3 h. NAC blocked HMGB1 production in a dose-dependent manner. Blocking with GZ, NAC, and JNK significantly suppressed AGE-induced VEGF-A production. CONCLUSIONS: HMGB1 is implicated in the production of VEGF-A in retinal ganglion cell line-5 (RGC-5). Blocking HMGB1, ROS, or the JNK pathway may attenuate VEGF-A production, suggesting HMGB1 and related signaling molecules play a role in diabetic retinopathy.
Assuntos
Produtos Finais de Glicação Avançada/farmacologia , Proteína HMGB1/biossíntese , RNA Mensageiro/biossíntese , Células Ganglionares da Retina/metabolismo , Fator A de Crescimento do Endotélio Vascular/biossíntese , Acetilcisteína/farmacologia , Animais , Antracenos/farmacologia , Bovinos , Linhagem Celular , Meios de Cultivo Condicionados/farmacologia , Relação Dose-Resposta a Droga , MAP Quinases Reguladas por Sinal Extracelular/antagonistas & inibidores , MAP Quinases Reguladas por Sinal Extracelular/metabolismo , Ácido Glicirrízico/farmacologia , Proteína HMGB1/metabolismo , MAP Quinase Quinase 4/antagonistas & inibidores , MAP Quinase Quinase 4/metabolismo , Ratos , Espécies Reativas de Oxigênio/antagonistas & inibidores , Espécies Reativas de Oxigênio/metabolismo , Células Ganglionares da Retina/citologia , Células Ganglionares da Retina/efeitos dos fármacos , Soroalbumina Bovina/farmacologia , Transdução de Sinais/efeitos dos fármacos , Fator A de Crescimento do Endotélio Vascular/metabolismo , Proteínas Quinases p38 Ativadas por Mitógeno/antagonistas & inibidores , Proteínas Quinases p38 Ativadas por Mitógeno/metabolismoRESUMO
We report a functional protease assay in which liquid crystals (LCs) are used as signal reporters to transduce the test results into optical signals. In this assay, an oligopeptide substrate (CLSELDDRADALQAGASQFESSAAKLKRKYWWKNLK) is used as a probe. This oligopeptide can be cleaved by α-chymotrypsin at multiple locations and become smaller fragments after the cleavage. When the original oligopeptide is immobilized on a solid surface, its long flexible oligopeptide chain is able to influence the orientation of a thin layer of LC supported on the surface, as is evident as a bright spot on the surface. In contrast, when the shorter oligopeptide fragments are immobilized on the same surface, their shorter, less flexible chains cannot disrupt the orientation of LC, and a dark spot is observed. On the basis of the dark or bright signal from LC, α-chymotrypsin in buffer solution or complex media such as chicken broth can be detected by using the naked eye. However, when the incubation time is 3h, the limit of detection (LOD) for α-chymotrypsin in buffer solution is 50 ng/mL, whereas that in chicken broth is only 500 ng/mL. Unlike traditional antibody-based assays which show little difference between active and inactive α-chymotrypsin, only active protease can be detected in this assay. This study shows the potential utility of LCs for detecting functional proteases with good specificity and sensitivity.
Assuntos
Técnicas Biossensoriais/métodos , Cristais Líquidos , Peptídeo Hidrolases/análise , Sequência de Aminoácidos , Animais , Técnicas Biossensoriais/estatística & dados numéricos , Bovinos , Quimotripsina/análise , Quimotripsina/química , Proteínas Imobilizadas/química , Limite de Detecção , Sondas Moleculares/química , Dados de Sequência Molecular , Peptídeo Hidrolases/química , Peptídeos/química , Especificidade por Substrato , Tripsina/análise , Tripsina/químicaRESUMO
PURPOSE: The purpose of this study was to evaluate the safety and efficacy of intravitreal bevacizumab in treatment-naive patients with choroidal neovascularization (CNV) secondary to pathologic myopia over a 2-year interval. METHODS: Patients diagnosed with myopic CNV who had not received previous treatment were given intravitreal injections of bevacizumab (2.5 mg/0.1 mL). All patients were retrospectively evaluated using best-corrected visual acuity (BCVA) and central macular thickness (CMT) measured with optical coherence tomography (OCT). RESULTS: Twenty-six eyes of 26 patients aged 15-81 years (mean, 42.6 years) were enrolled. OCT images demonstrated that the mean CMT±standard deviation (SD) significantly changed from 270±47 µm at baseline to 228±35, 218±35, 212±25, 210±29, and 209±30 µm in the 1st, 3rd, 6th, 12th, and 24th post-treatment months, respectively (P<0.001 for all). The BCVA in logarithm of the minimum angle of resolution±SD significantly changed from 0.75±0.43 at baseline to 0.57±0.44, 0.42±0.44, 0.39±0.47, 0.41±0.44, and 0.42±0.41 in the 1st, 3rd, 6th, 12th, and 24th post-treatment months, respectively (P<0.001 for all). The mean number of injections was 1.69 (range, 1-4) within the 24-month period. The follow-up period ranged from 24 to 35 months (mean, 28 months). No other ocular or systemic adverse effects were observed. CONCLUSIONS: Although the present study lacked a control group, the results in this small series of patients over the 2-year follow-up period indicate that intravitreal injection of 2.5 mg bevacizumab is effective and safe in patients with myopic CNV.
Assuntos
Inibidores da Angiogênese/uso terapêutico , Anticorpos Monoclonais Humanizados/uso terapêutico , Neovascularização de Coroide/tratamento farmacológico , Miopia Degenerativa/tratamento farmacológico , Adolescente , Adulto , Idoso , Idoso de 80 Anos ou mais , Inibidores da Angiogênese/administração & dosagem , Inibidores da Angiogênese/efeitos adversos , Anticorpos Monoclonais Humanizados/administração & dosagem , Anticorpos Monoclonais Humanizados/efeitos adversos , Bevacizumab , Neovascularização de Coroide/etiologia , Feminino , Seguimentos , Humanos , Injeções Intravítreas , Masculino , Pessoa de Meia-Idade , Miopia Degenerativa/complicações , Estudos Retrospectivos , Tomografia de Coerência Óptica , Acuidade Visual/efeitos dos fármacos , Adulto JovemRESUMO
PURPOSE: The purpose of this study was to evaluate the effects of intravitreal bevacizumab (ivBe) injection in patients with persistent macular edema after macular epiretinal membrane (ERM) removal. METHODS: This retrospective study included 26 patients (26 eyes) with marked macular edema after complete removal of idiopathic macular ERM who received single ivBe injection (12 patients) or no treatment (controls, 14 patients). Main outcome measurements were central macular thickness (CMT) and best-corrected visual acuity (BCVA). RESULTS: In the ivBe group, the mean CMT±standard deviation (SD) changed significantly from 323±43 µm at baseline to 306±41, 301±42, and 296±41 µm at weeks 4, 8, and 12, respectively, after treatment (P= 0.025, <0.0001, and <0.0001, respectively). The BCVA in logarithm of the minimum angle of resolution (logMAR)±SD did not change significantly from 0.50±0.15 at baseline to 0.46±0.11, 0.44±0.14, 0.44±0.14, and 0.42±0.13 at weeks 1, 4, 8, and 12, respectively, after treatment (P>0.05 for all). In the control group, the mean CMT±SD changed significantly from 326±32 µm at baseline to 314±29, 308±29, and 307±30 µm at weeks 4, 8, and 12, respectively, after treatment (P=0.002, <0.0001, and <0.0001, respectively). The BCVA in logMAR±SD did not change significantly from 0.52±0.22 at baseline to 0.49±0.20, 0.47±0.22, 0.45±0.16, and 0.47±0.23 at modified weeks 1, 4, 8, and 12, respectively, after treatment (P>0.05 for all). No significant differences were found for CMT or BCVA between the ivBe group and the control group at baseline and at any checkpoints after treatment (P>0.05 for all). CONCLUSION: ivBe injection therapy provided no beneficial effects on CMT or visual acuity improvement for eyes with persistent macular edema after idiopathic macular ERM removal.
Assuntos
Anticorpos Monoclonais/uso terapêutico , Membrana Epirretiniana/cirurgia , Edema Macular/tratamento farmacológico , Complicações Pós-Operatórias/tratamento farmacológico , Fatores de Crescimento do Endotélio Vascular/antagonistas & inibidores , Vitrectomia , Adulto , Idoso , Anticorpos Monoclonais/administração & dosagem , Anticorpos Monoclonais/efeitos adversos , Anticorpos Monoclonais Humanizados , Bevacizumab , Feminino , Humanos , Injeções Intravítreas , Macula Lutea/efeitos dos fármacos , Macula Lutea/patologia , Edema Macular/patologia , Masculino , Prontuários Médicos , Pessoa de Meia-Idade , Estudos Retrospectivos , Fatores de Tempo , Tomografia de Coerência Óptica , Acuidade Visual/efeitos dos fármacosRESUMO
BACKGROUND: To evaluate the effects of a single intravitreal injection of triamcinolone acetonide (ivTA) or bevacizumab (ivBe) on visual acuity and central macular thickness (CMT) in cases of macular edema secondary to branch retinal vein occlusion (BRVO) for eyes that are treatment-naïve. METHODS: This consecutive, retrospective, nonrandomized, clinical interventional study included 83 patients (83 eyes) with macular edema secondary to BRVO who received single ivTA (25 patients) or ivBe (24 patients) injections, or no treatment (controls, 34). The main outcomes included CMT measurements using optical coherence tomography (OCT) and best-corrected visual acuity (BCVA). RESULTS: CMT decreased significantly from baseline at 4, 8, 12 and 24 weeks after treatment (p < 0.05) in both the intravitreal groups and the control group. BCVA improved significantly from baseline at 4 and 8 weeks after treatment among the ivTA group (p < 0.05) and at 4, 8 and 12 weeks after treatment among the ivBe group (p < 0.05). Comparing CMT between the groups, significant differences were found between ivTA and control groups and ivBe and control groups at the 4- and 8- week checkpoints (p < 0.05). Significant differences were found in BCVA only between ivBe and control groups at the 8-week checkpoint (p = 0.049). No significant differences were found for CMT and BCVA between the ivBe and ivTA groups (p > 0.05) at any checkpoint after treatment. No patient experienced immediate procedure-related complications or any obvious systemic adverse events in either the ivTA group or the ivBe group. Delayed complications included steroid induced ocular hypertension in eight eyes (32%) and development of posterior subcapsular cataracts in five eyes (28%) in the ivTA group. CONCLUSIONS: Both the ivTA and ivBe therapies were beneficial short-term treatment options for the treatment of macular edema secondary to BRVO. However, the ivBe treatment appears to be safer and less prone to adverse side effects such as ocular hypertension and cataract compared with ivTA therapy.
Assuntos
Anticorpos Monoclonais/administração & dosagem , Edema Macular/tratamento farmacológico , Oclusão da Veia Retiniana/complicações , Triancinolona Acetonida/administração & dosagem , Adulto , Idoso , Anticorpos Monoclonais/efeitos adversos , Anticorpos Monoclonais Humanizados , Bevacizumab , Feminino , Humanos , Edema Macular/patologia , Masculino , Pessoa de Meia-Idade , Retina/patologia , Estudos Retrospectivos , Triancinolona Acetonida/efeitos adversos , Acuidade VisualRESUMO
PURPOSE: To evaluate the effect of adjunctive intravitreal bevacizumab (ivBe) with trabeculectomy versus trabeculectomy alone in the management of patients with neovascular glaucoma (NVG). METHODS: Retrospective, consecutive, interventional case series. NVG patients were divided into groups by treatment: with adjunctive ivBe and trabeculectomy (ivBe group, n = 14 eyes) and with trabeculectomy only (control group, n = 28 eyes). The main outcome measure was visual acuity. Regression of iris neovascularization (NVI), change(s) in intraocular pressure (IOP), NVI recurrence, additional glaucoma surgeries required, eyes of leading to total blindness, intraoperative and postoperative complications, and number of topical medications required after trabeculectomy were regarded as second outcome measures. In the ivBe group, intravitreal injections of 2.5 mg bevacizumab were delivered using a sharp 27-gauge needle through the inferotemporal quadrant. RESULTS: Of 42 eyes of 42 patients identified, change in IOP, additional glaucoma surgeries required, and number of IOP-lowering topical medications required after trabeculectomy did not differ significantly between groups (P > 0.05 for all). However, the ivBe group had significantly higher frequency and rapidity of iris neovascular regression, improved visual acuity in the logarithm of minimum angle of resolution (logMAR), leading to total blindness in fewer eyes and intraoperative and postoperative complications in others than in the control group (P = 0.015, 0.002, 0.007, 0.023, and 0.008, respectively). The follow-up duration (mean +/- SD) from trabeculectomy surgery was 179 +/- 97 days (range, 93-315 days) and 196 +/- 108 days (range, 92-370 days) in the ivBe and control group (P = 0.324). CONCLUSIONS: Intravitreal bevacizumab might be a useful adjunctive therapy in addition to trabeculectomy in the management of NVG. Large controlled randomized studies for treatment of bevacizumab on NVG are warranted.
Assuntos
Anticorpos Monoclonais/administração & dosagem , Glaucoma Neovascular/tratamento farmacológico , Glaucoma Neovascular/cirurgia , Trabeculectomia , Adulto , Idoso , Anticorpos Monoclonais/efeitos adversos , Anticorpos Monoclonais Humanizados , Bevacizumab , Quimioterapia Adjuvante , Feminino , Seguimentos , Glaucoma Neovascular/complicações , Glaucoma Neovascular/fisiopatologia , Humanos , Injeções Intraoculares , Complicações Intraoperatórias , Iris/irrigação sanguínea , Masculino , Pessoa de Meia-Idade , Neovascularização Patológica/etiologia , Neovascularização Patológica/fisiopatologia , Complicações Pós-Operatórias , Estudos Retrospectivos , Índice de Gravidade de Doença , Trabeculectomia/efeitos adversos , Resultado do Tratamento , Acuidade Visual/efeitos dos fármacos , Corpo VítreoRESUMO
PURPOSE: The aim of this study was to assess the efficacy of phacoemulsification combined with intravitreal (i.v.t.) bevacizumab injection in diabetics with clinically significant macular edema (CSME) and cataract. METHODS: This retrospective study included diabetic patients with cataract and CSME who underwent phacoemulsification and intraocular lens implantation with a 2.5-mg bevacizumab i.v.t injection (ivBe) (15 eyes) or without ivBe (controls, 14 eyes). Best-corrected visual acuity (BCVA), central macular thickness (CMT) measured by optic coherence tomography (OCT), and adverse events were recorded. RESULTS: In the ivBe group, the OCT images demonstrated that CMT (mean +/- standard deviation [SD]) decreased significantly from 466 +/- 105 at baseline to 333 +/- 107, 313 +/- 138 and 333 +/- 111 microm at 4, 8, and 12 weeks, respectively, after treatment (P < 0.05). The visual acuity in logMAR (mean +/- SD) improved significantly from 1.66 +/- 0.39 at baseline to 1.30 +/- 0.50, 1.15 +/- 0.42, 0.99 +/- 0.48, and 1.03+/- 0.44 at 1, 4, 8, and 12 weeks, respectively, after treatment (P < 0.05). However, in the control group, the CMT changed insignificantly from 443 +/- 109 at baseline to 463 +/- 106, 425 +/- 128, and 421 +/- 119 microm at 4, 8 and 12 weeks, respectively after treatment (P > 0.05). The visual acuity in logMAR improved insignificantly from 1.63 +/- 0.42 at baseline to 1.43 +/- 0.53, and 1.39 +/- 0.43 at 1, and 4 weeks (P > 0.05) and significantly to 1.24 +/- 0.45 and 1.18 +/- 0.44 at 8 and 12 weeks, respectively, after treatment (P < 0.05). None of the patients in both groups experienced injection- or surgery-related complications or any obvious systemic adverse events. CONCLUSIONS: The short-term results suggest that phacoemulsification with i.v.t. bevacizumab safely reduces macular edema and improves visual acuity for cataract and CSME in diabetics.
Assuntos
Inibidores da Angiogênese/uso terapêutico , Anticorpos Monoclonais/uso terapêutico , Catarata/terapia , Retinopatia Diabética/complicações , Edema Macular/complicações , Edema Macular/terapia , Facoemulsificação , Idoso , Inibidores da Angiogênese/efeitos adversos , Anticorpos Monoclonais/efeitos adversos , Anticorpos Monoclonais Humanizados , Bevacizumab , Catarata/complicações , Terapia Combinada , Feminino , Humanos , Injeções , Implante de Lente Intraocular , Masculino , Pessoa de Meia-Idade , Estudos Retrospectivos , Tomografia de Coerência Óptica , Acuidade Visual , Corpo VítreoRESUMO
New CN donor ligands incorporating pyridine or benzoimidazole N donors and a sterically hindered cyclometalating aromatic core featuring a polyphenylenephenyl, fluoranthene, or triphenylene segment are prepared and successfully converted into heteroleptic iridium(III) cyclometalated complexes with acetylacetone auxiliary ligands. The X-ray structure of the complex, derived from a ligand containing a fluoranthene fragment, has been solved to unveil the corresponding structure. The results clearly demonstrate that the nature of the sigma-coordinating ligand segment plays a key role in dictating the emission profile and peak position, such that the emission hue has been successfully tuned ranging from green to red. Supplementary support of this viewpoint is also rendered by computational (DFT) approaches. Electroluminescent devices fabricated using a complex as dopant in the PVK matrix were found to exhibit bright greenish yellow emission with promising device characteristics (maximum brightness 26450 cd m(-2) at 30 V and a maximum current efficiency of 40 cd A(-1)).
Assuntos
Irídio/química , Substâncias Luminescentes/síntese química , Compostos Macrocíclicos/síntese química , Cristalografia por Raios X , Eletroquímica , Ligantes , Substâncias Luminescentes/química , Compostos Macrocíclicos/química , Modelos Moleculares , Estrutura Molecular , EspectrofotometriaRESUMO
The use of high or medium-intensity lasers to create an anastomotic connection between a retinal vein and a choroidal vein for the treatment of nonischemic central retinal vein occlusion (CRVO) has shown encouraging results. We established communication between an obstructed retinal vein and the choroid using a modified laser application in the eye of a 17-year-old boy with progressive nonischemic CRVO with macular edema and achieved excellent anatomic and visual results. The macular edema totally resolved and visual acuity significantly improved from 6/60 to 6/6.
Assuntos
Anastomose Cirúrgica/métodos , Corioide/irrigação sanguínea , Terapia a Laser , Oclusão da Veia Retiniana/cirurgia , Adolescente , Humanos , Masculino , Acuidade VisualRESUMO
The 14-3-3 sigma (sigma) protein, a negative regulator of the cell cycle, is a human mammary epithelium-specific marker that is downregulated in transformed mammary carcinoma cells. It has also been identified as a p53-inducible gene product involved in cell cycle checkpoint control after DNA damage. Although 14-3-3 sigma is linked to p53-regulated cell cycle checkpoint control, detailed mechanisms of how cell cycle regulation occurs remain unclear. Decreased expression of 14-3-3 sigma was recently reported in several types of carcinomas, further suggesting that the negative regulatory role of 14-3-3 sigma in the cell cycle is compromised during tumorigenesis. However, this possible tumor-suppressive role of 14-3-3 sigma has not yet been characterized. Here, we studied the link between 14-3-3 sigma activities and p53 regulation. We found that 14-3-3 sigma interacted with p53 in response to the DNA-damaging agent adriamycin. Importantly, 14-3-3 sigma expression led to stabilized expression of p53. In studying the molecular mechanism of this increased stabilization of p53, we found that 14-3-3 sigma antagonized the biological functions of Mdm2 by blocking Mdm2-mediated p53 ubiquitination and nuclear export. In addition, we found that 14-3-3 sigma facilitated the oligomerization of p53 and enhanced p53's transcriptional activity. As a target gene of p53, 14-3-3 sigma appears to have a positive feedback effect on p53 activity. Significantly, we also showed that overexpression of 14-3-3 sigma inhibited oncogene-activated tumorigenicity in a tetracycline-regulated 14-3-3 sigma system. These results defined an important p53 regulatory loop and suggested that 14-3-3 sigma expression can be considered for therapeutic intervention in cancers.