Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 19 de 19
Filtrar
Mais filtros











Intervalo de ano de publicação
1.
Sci Rep ; 11(1): 4009, 2021 02 17.
Artigo em Inglês | MEDLINE | ID: mdl-33597701

RESUMO

Analysis of spider venom gland transcriptomes focuses on the identification of possible neurotoxins, proteins and enzymes. Here, the first comprehensive transcriptome analysis of cupiennins, small linear cationic peptides, also known as cytolytic or antimicrobial peptides, is reported from the venom gland transcriptome of Cupiennius salei by 454- and Illumina 3000 sequencing. Four transcript families with complex precursor structures are responsible for the expression of 179 linear peptides. Within the transcript families, after an anionic propeptide, cationic linear peptides are separated by anionic linkers, which are transcript family specific. The C-terminus of the transcript families is characterized by a linear peptide or truncated linkers with unknown function. A new identified posttranslational processing mechanism explains the presence of the two-chain CsTx-16 family in the venom. The high diversity of linear peptides in the venom of a spider and this unique synthesis process is at least genus specific as verified with Cupiennius getazi.


Assuntos
Venenos de Aranha/genética , Venenos de Aranha/metabolismo , Sequência de Aminoácidos , Animais , Peptídeos Catiônicos Antimicrobianos/genética , Peptídeos Catiônicos Antimicrobianos/metabolismo , Expressão Gênica/genética , Perfilação da Expressão Gênica/métodos , Neurotoxinas/química , Peptídeos/química , Venenos de Aranha/química , Aranhas/genética , Transcriptoma/genética
2.
Toxins (Basel) ; 12(4)2020 04 12.
Artigo em Inglês | MEDLINE | ID: mdl-32290562

RESUMO

The venom of Cupiennius salei is composed of dozens of neurotoxins, with most of them supposed to act on ion channels. Some insecticidal monomeric neurotoxins contain an α-helical part besides their inhibitor cystine knot (ICK) motif (type 1). Other neurotoxins have, besides the ICK motif, an α-helical part of an open loop, resulting in a heterodimeric structure (type 2). Due to their low toxicity, it is difficult to understand the existence of type 2 peptides. Here, we show with the voltage clamp technique in oocytes of Xenopus laevis that a combined application of structural type 1 and type 2 neurotoxins has a much more pronounced cytolytic effect than each of the toxins alone. In biotests with Drosophila melanogaster, the combined effect of both neurotoxins was enhanced by 2 to 3 log units when compared to the components alone. Electrophysiological measurements of a type 2 peptide at 18 ion channel types, expressed in Xenopus laevis oocytes, showed no effect. Microscale thermophoresis data indicate a monomeric/heterodimeric peptide complex formation, thus a direct interaction between type 1 and type 2 peptides, leading to cell death. In conclusion, peptide mergers between both neurotoxins are the main cause for the high cytolytic activity of Cupienniussalei venom.


Assuntos
Membrana Celular/efeitos dos fármacos , Drosophila melanogaster/efeitos dos fármacos , Canais Iônicos/efeitos dos fármacos , Neurotoxinas/toxicidade , Venenos de Aranha/toxicidade , Animais , Membrana Celular/metabolismo , Drosophila melanogaster/genética , Drosophila melanogaster/metabolismo , Canais Iônicos/genética , Canais Iônicos/metabolismo , Potenciais da Membrana , Modelos Moleculares , Neurotoxinas/química , Venenos de Aranha/química , Relação Estrutura-Atividade , Xenopus laevis
3.
Toxins (Basel) ; 11(10)2019 10 22.
Artigo em Inglês | MEDLINE | ID: mdl-31652611

RESUMO

This review gives an overview on the development of research on spider venoms with a focus on structure and function of venom components and techniques of analysis. Major venom component groups are small molecular mass compounds, antimicrobial (also called cytolytic, or cationic) peptides (only in some spider families), cysteine-rich (neurotoxic) peptides, and enzymes and proteins. Cysteine-rich peptides are reviewed with respect to various structural motifs, their targets (ion channels, membrane receptors), nomenclature, and molecular binding. We further describe the latest findings concerning the maturation of antimicrobial, and cysteine-rich peptides that are in most known cases expressed as propeptide-containing precursors. Today, venom research, increasingly employs transcriptomic and mass spectrometric techniques. Pros and cons of venom gland transcriptome analysis with Sanger, 454, and Illumina sequencing are discussed and an overview on so far published transcriptome studies is given. In this respect, we also discuss the only recently described cross contamination arising from multiplexing in Illumina sequencing and its possible impacts on venom studies. High throughput mass spectrometric analysis of venom proteomes (bottom-up, top-down) are reviewed.


Assuntos
Venenos de Aranha , Animais , Perfilação da Expressão Gênica , Humanos , Proteômica , Venenos de Aranha/química , Venenos de Aranha/genética , Venenos de Aranha/toxicidade
4.
Toxins (Basel) ; 11(3)2019 03 19.
Artigo em Inglês | MEDLINE | ID: mdl-30893800

RESUMO

Most knowledge of spider venom concerns neurotoxins acting on ion channels, whereas proteins and their significance for the envenomation process are neglected. The here presented comprehensive analysis of the venom gland transcriptome and proteome of Cupiennius salei focusses on proteins and cysteine-containing peptides and offers new insight into the structure and function of spider venom, here described as the dual prey-inactivation strategy. After venom injection, many enzymes and proteins, dominated by α-amylase, angiotensin-converting enzyme, and cysteine-rich secretory proteins, interact with main metabolic pathways, leading to a major disturbance of the cellular homeostasis. Hyaluronidase and cytolytic peptides destroy tissue and membranes, thus supporting the spread of other venom compounds. We detected 81 transcripts of neurotoxins from 13 peptide families, whereof two families comprise 93.7% of all cysteine-containing peptides. This raises the question of the importance of the other low-expressed peptide families. The identification of a venom gland-specific defensin-like peptide and an aga-toxin-like peptide in the hemocytes offers an important clue on the recruitment and neofunctionalization of body proteins and peptides as the origin of toxins.


Assuntos
Proteoma , Venenos de Aranha/química , Transcriptoma , Animais , Proteínas de Artrópodes/análise , Neurotoxinas/análise , Peptídeos/análise , Comportamento Predatório , Aranhas
5.
Toxins (Basel) ; 9(8)2017 08 08.
Artigo em Inglês | MEDLINE | ID: mdl-28786958

RESUMO

Spider venoms are rich cocktails of bioactive peptides, proteins, and enzymes that are being intensively investigated over the years. In order to provide a better comprehension of that richness, we propose a three-level family classification system for spider venom components. This classification is supported by an exhaustive set of 219 new profile hidden Markov models (HMMs) able to attribute a given peptide to its precise peptide type, family, and group. The proposed classification has the advantages of being totally independent from variable spider taxonomic names and can easily evolve. In addition to the new classifiers, we introduce and demonstrate the efficiency of hmmcompete, a new standalone tool that monitors HMM-based family classification and, after post-processing the result, reports the best classifier when multiple models produce significant scores towards given peptide queries. The combined used of hmmcompete and the new spider venom component-specific classifiers demonstrated 96% sensitivity to properly classify all known spider toxins from the UniProtKB database. These tools are timely regarding the important classification needs caused by the increasing number of peptides and proteins generated by transcriptomic projects.


Assuntos
Proteínas de Artrópodes/classificação , Neurotoxinas/classificação , Peptídeos/classificação , Venenos de Aranha/classificação , Animais , Bases de Dados de Proteínas , Proteômica , Aranhas
6.
PLoS One ; 12(3): e0172966, 2017.
Artigo em Inglês | MEDLINE | ID: mdl-28306751

RESUMO

Venom based research is exploited to find novel candidates for the development of innovative pharmacological tools, drug candidates and new ingredients for cosmetic and agrochemical industries. Moreover, venomics, as a well-established approach in systems biology, helps to elucidate the genetic mechanisms of the production of such a great molecular biodiversity. Today the advances made in the proteomics, transcriptomics and bioinformatics fields, favor venomics, allowing the in depth study of complex matrices and the elucidation even of minor compounds present in minute biological samples. The present study illustrates a rapid and efficient method developed for the elucidation of venom composition based on NextGen mRNA sequencing of venom glands and LC-MS/MS venom proteome profiling. The analysis of the comprehensive data obtained was focused on cysteine rich peptide toxins from four spider species originating from phylogenetically distant families for comparison purposes. The studied species were Heteropoda davidbowie (Sparassidae), Poecilotheria formosa (Theraphosidae), Viridasius fasciatus (Viridasiidae) and Latrodectus mactans (Theridiidae). This led to a high resolution profiling of 284 characterized cysteine rich peptides, 111 of which belong to the Inhibitor Cysteine Knot (ICK) structural motif. The analysis of H. davidbowie venom revealed a high richness in term of venom diversity: 95 peptide sequences were identified; out of these, 32 peptides presented the ICK structural motif and could be classified in six distinct families. The profiling of P. formosa venom highlighted the presence of 126 peptide sequences, with 52 ICK toxins belonging to three structural distinct families. V. fasciatus venom was shown to contain 49 peptide sequences, out of which 22 presented the ICK structural motif and were attributed to five families. The venom of L. mactans, until now studied for its large neurotoxins (Latrotoxins), revealed the presence of 14 cysteine rich peptides, out of which five were ICK toxins belonging to the CSTX superfamily. This in depth profiling of distinct ICK peptide families identified across the four spider species highlighted the high conservation of these neurotoxins among spider families.


Assuntos
Peptídeos/metabolismo , Venenos de Aranha/metabolismo , Transcriptoma , Cromatografia Líquida , Espectrometria de Massas em Tandem
7.
Sci Rep ; 6: 29538, 2016 07 07.
Artigo em Inglês | MEDLINE | ID: mdl-27383378

RESUMO

The inexorable decline in the armament of registered chemical insecticides has stimulated research into environmentally-friendly alternatives. Insecticidal spider-venom peptides are promising candidates for bioinsecticide development but it is challenging to find peptides that are specific for targeted pests. In the present study, we isolated an insecticidal peptide (Ae1a) from venom of the African spider Augacephalus ezendami (family Theraphosidae). Injection of Ae1a into sheep blowflies (Lucilia cuprina) induced rapid but reversible paralysis. In striking contrast, Ae1a was lethal to closely related fruit flies (Drosophila melanogaster) but induced no adverse effects in the recalcitrant lepidopteran pest Helicoverpa armigera. Electrophysiological experiments revealed that Ae1a potently inhibits the voltage-gated sodium channel BgNaV1 from the German cockroach Blattella germanica by shifting the threshold for channel activation to more depolarized potentials. In contrast, Ae1a failed to significantly affect sodium currents in dorsal unpaired median neurons from the American cockroach Periplaneta americana. We show that Ae1a interacts with the domain II voltage sensor and that sensitivity to the toxin is conferred by natural sequence variations in the S1-S2 loop of domain II. The phyletic specificity of Ae1a provides crucial information for development of sodium channel insecticides that target key insect pests without harming beneficial species.


Assuntos
Inseticidas/farmacologia , Peptídeos/farmacologia , Venenos de Aranha/química , Aranhas/fisiologia , Canais de Sódio Disparados por Voltagem/química , Animais , Blattellidae/efeitos dos fármacos , Dípteros/efeitos dos fármacos , Drosophila melanogaster/efeitos dos fármacos , Avaliação Pré-Clínica de Medicamentos/métodos , Proteínas de Insetos/antagonistas & inibidores , Proteínas de Insetos/metabolismo , Inseticidas/química , Lepidópteros/efeitos dos fármacos , Canal de Sódio Disparado por Voltagem NAV1.5/metabolismo , Peptídeos/genética , Peptídeos/isolamento & purificação , Periplaneta/efeitos dos fármacos , Proteínas Recombinantes/genética , Proteínas Recombinantes/farmacologia , Aranhas/química , Bloqueadores do Canal de Sódio Disparado por Voltagem/farmacologia , Canais de Sódio Disparados por Voltagem/metabolismo
8.
Sci. rep. (Nat. Publ. Group) ; 6(29538): [11], 2016. ilus
Artigo em Inglês | LILACS, BVSDIP | ID: biblio-1560675

RESUMO

The inexorable decline in the armament of registered chemical insecticides has stimulated research into environmentally-friendly alternatives. Insecticidal spider-venom peptides are promising candidates for bioinsecticide development but it is challenging to find peptides that are specific for targeted pests. In the present study, we isolated an insecticidal peptide (Ae1a) from venom of the African spider Augacephalus ezendami (family Theraphosidae). Injection of Ae1a into sheep blowflies (Lucilia cuprina) induced rapid but reversible paralysis. In striking contrast, Ae1a was lethal to closely related fruit flies (Drosophila melanogaster) but induced no adverse effects in the recalcitrant lepidopteran pest Helicoverpa armigera. Electrophysiological experiments revealed that Ae1a potently inhibits the voltage-gated sodium channel BgNaV1 from the German cockroach Blattella germanica by shifting the threshold for channel activation to more depolarized potentials. In contrast, Ae1a failed to significantly affect sodium currents in dorsal unpaired median neurons from the American cockroach Periplaneta americana. We show that Ae1a interacts with the domain II voltage sensor and that sensitivity to the toxin is conferred by natural sequence variations in the S1­S2 loop of domain II. The phyletic specificity of Ae1a provides crucial information for development of sodium channel insecticides that target key insect pests without harming beneficial species.


Assuntos
Peptídeos , Rhodnius , Venenos de Aranha , Inseticidas
9.
Toxicon ; 75: 177-86, 2013 Dec 01.
Artigo em Inglês | MEDLINE | ID: mdl-23523532

RESUMO

Cupiennins are small cationic α-helical peptides from the venom of the ctenid spider Cupiennius salei which are characterized by high bactericidal as well as hemolytic activities. To gain insight into the determinants responsible for the broad cytolytic activities, two analogues of cupiennin 1a with different N-terminal hydrophobicities were designed. The insecticidal, bactericidal and hemolytic activities of these analogues were assayed and compared to the native peptide. Specifically, substitution of two N-terminal Phe residues by Ala results in less pronounced insecticidal and cytolytic activity, whereas a substitution by Lys reduces strongly its bactericidal activity and completely diminishes its hemolytic activity up to very high tested concentrations. Biophysical analyses of peptide/bilayer membrane interactions point to distinct interactions of the analogues with lipid bilayers, and dependence upon membrane surface charge. Indeed, we find that lower hemolytic activity was correlated with less surface association of the analogues. In contrast, our data indicate that the reduced bactericidal activity of the two cupiennin 1a analogues likely correspond to greater bilayer-surface localization of the peptides. Overall, ultimate insertion and destruction of the host cell membrane is highly dependent on the presence of Phe-2 and Phe-6 (Cu 1a) or Leu-6 (Cu 2a) in the N-terminal sequences of native cupiennins.


Assuntos
Peptídeos/química , Venenos de Aranha/química , Sequência de Aminoácidos , Aminoácidos/química , Animais , Antibacterianos/química , Antibacterianos/isolamento & purificação , Antibacterianos/farmacologia , Peptídeos Catiônicos Antimicrobianos , Bactérias/efeitos dos fármacos , Bioensaio , Membrana Celular/efeitos dos fármacos , Dicroísmo Circular , Drosophila melanogaster/efeitos dos fármacos , Hemólise , Humanos , Inseticidas/química , Inseticidas/isolamento & purificação , Inseticidas/farmacologia , Bicamadas Lipídicas/química , Dados de Sequência Molecular , Peptídeos/isolamento & purificação , Peptídeos/farmacologia , Venenos de Aranha/isolamento & purificação , Venenos de Aranha/farmacologia , Aranhas
10.
FEBS J ; 279(15): 2683-94, 2012 Aug.
Artigo em Inglês | MEDLINE | ID: mdl-22672445

RESUMO

The multicomponent venom of the spider Cupiennius salei was separated by three different chromatographic strategies to facilitate subsequent analysis of peptidic venom components by tandem mass spectrometry (MALDI-TOF-MS and ESI-MS), Edman degradation and amino acid analysis: (a) desalting of the crude venom by RP-HPLC only, (b) chromatographic separation of the crude venom into 42 fractions by RP-HPLC, and (c) multidimensional purification of the crude venom by size exclusion and cation exchange chromatography and RP-HPLC. A total of 286 components were identified in the venom of C. salei by mass spectrometry and the sequence of 49 new peptides was determined de novo by Edman degradation and tandem mass spectrometry; 30 were C-terminally amidated. The novel peptides were assigned to two main groups: (a) short cationic peptides and (b) Cys-containing peptides with the inhibitor cystine knot motif. Bioinformatics revealed a limited number of substantial similarities, namely with the peptides CpTx1 from the spider Cheiracantium punctorium and U3-ctenitoxin-Asp1a from the South American fishing spider (Ancylometes sp.) and with sequences from a Lycosa singoriensis venom gland transcriptome analysis. The results clearly indicate that the quality of the data is strongly dependent on the chosen separation strategy. The combination of orthogonal analytical methods efficiently excludes alkali ion and matrix adducts, provides indispensable information for an unambiguous identification of isomasses, and results in the most comprehensive repertoire of peptides identified in the venom of C. salei so far.


Assuntos
Venenos de Aranha/química , Sequência de Aminoácidos , Animais , Cromatografia Líquida de Alta Pressão , Cromatografia por Troca Iônica , Biologia Computacional , Dados de Sequência Molecular , Peptídeos/química , Peptídeos/genética , Peptídeos/isolamento & purificação , Alinhamento de Sequência , Homologia de Sequência de Aminoácidos , Espectrometria de Massas por Ionização por Electrospray , Espectrometria de Massas por Ionização e Dessorção a Laser Assistida por Matriz , Venenos de Aranha/genética , Venenos de Aranha/isolamento & purificação , Aranhas/química , Aranhas/genética , Espectrometria de Massas em Tandem
11.
J Biol Chem ; 287(30): 25640-9, 2012 Jul 20.
Artigo em Inglês | MEDLINE | ID: mdl-22613721

RESUMO

CsTx-1, the main neurotoxic acting peptide in the venom of the spider Cupiennius salei, is composed of 74 amino acid residues, exhibits an inhibitory cysteine knot motif, and is further characterized by its highly cationic charged C terminus. Venom gland cDNA library analysis predicted a prepropeptide structure for CsTx-1 precursor. In the presence of trifluoroethanol, CsTx-1 and the long C-terminal part alone (CT1-long; Gly-45-Lys-74) exhibit an α-helical structure, as determined by CD measurements. CsTx-1 and CT1-long are insecticidal toward Drosophila flies and destroys Escherichia coli SBS 363 cells. CsTx-1 causes a stable and irreversible depolarization of insect larvae muscle cells and frog neuromuscular preparations, which seem to be receptor-independent. Furthermore, this membranolytic activity could be measured for Xenopus oocytes, in which CsTx-1 and CT1-long increase ion permeability non-specifically. These results support our assumption that the membranolytic activities of CsTx-1 are caused by its C-terminal tail, CT1-long. Together, CsTx-1 exhibits two different functions; as a neurotoxin it inhibits L-type Ca(2+) channels, and as a membranolytic peptide it destroys a variety of prokaryotic and eukaryotic cell membranes. Such a dualism is discussed as an important new mechanism for the evolution of spider venomous peptides.


Assuntos
Evolução Molecular , Neurotoxinas/química , Venenos de Aranha/química , Aranhas/química , Animais , Canais de Cálcio Tipo L/química , Canais de Cálcio Tipo L/genética , Canais de Cálcio Tipo L/metabolismo , Membrana Celular/química , Membrana Celular/genética , Membrana Celular/metabolismo , DNA Complementar/genética , Drosophila melanogaster , Escherichia coli/genética , Escherichia coli/crescimento & desenvolvimento , Escherichia coli/metabolismo , Feminino , Músculo Esquelético/química , Músculo Esquelético/metabolismo , Neurotoxinas/genética , Estrutura Terciária de Proteína , Rana temporaria , Venenos de Aranha/genética , Aranhas/genética , Xenopus laevis
12.
Amino Acids ; 40(1): 69-76, 2011 Jan.
Artigo em Inglês | MEDLINE | ID: mdl-20140690

RESUMO

Cupiennin 1a, a cytolytic peptide isolated from the venom of the spider Cupiennius salei, exhibits broad membranolytic activity towards bacteria, trypanosomes, and plasmodia, as well as human blood and cancer cells. In analysing the cytolytic activity of synthesised all-D: - and all-L: -cupiennin 1a towards pro- and eukaryotic cells, a stereospecific mode of membrane destruction could be excluded. The importance of negatively charged sialic acids on the outer leaflet of erythrocytes for the binding and haemolytic activity of L: -cupiennin 1a was demonstrated. Reducing the overall negative charges of erythrocytes by partially removing their sialic acids or by protecting them with tri- or pentalysine results in reduced haemolytic activity of the peptide.


Assuntos
Anti-Infecciosos/farmacologia , Antineoplásicos/farmacologia , Citotoxinas/farmacologia , Inseticidas/farmacologia , Peptídeos/farmacologia , Venenos de Aranha/farmacologia , Aranhas/química , Animais , Anti-Infecciosos/química , Peptídeos Catiônicos Antimicrobianos , Antineoplásicos/química , Bactérias/efeitos dos fármacos , Linhagem Celular Tumoral , Citotoxinas/química , Drosophila melanogaster/efeitos dos fármacos , Humanos , Inseticidas/química , Estrutura Molecular , Parasitos/efeitos dos fármacos , Peptídeos/química , Venenos de Aranha/química
13.
Cell Mol Life Sci ; 67(16): 2787-98, 2010 Aug.
Artigo em Inglês | MEDLINE | ID: mdl-20369272

RESUMO

Three novel glycine-rich peptides, named ctenidin 1-3, with activity against the Gram-negative bacterium E. coli, were isolated and characterized from hemocytes of the spider Cupiennius salei. Ctenidins have a high glycine content (>70%), similarly to other glycine-rich peptides, the acanthoscurrins, from another spider, Acanthoscurria gomesiana. A combination of mass spectrometry, Edman degradation, and cDNA cloning revealed the presence of three isoforms of ctenidin, at least two of them originating from simple, intronless genes. The full-length sequences of the ctenidins consist of a 19 amino acid residues signal peptide followed by the mature peptides of 109, 119, or 120 amino acid residues. The mature peptides are post-translationally modified by the cleavage of one or two C-terminal cationic amino acid residue(s) and amidation of the newly created mature C-terminus. Tissue expression analysis revealed that ctenidins are constitutively expressed in hemocytes and to a small extent also in the subesophageal nerve mass.


Assuntos
Peptídeos Catiônicos Antimicrobianos/química , Bactérias Gram-Negativas/efeitos dos fármacos , Hemócitos/metabolismo , Peptídeos/farmacologia , Aranhas/química , Aranhas/genética , Sequência de Aminoácidos , Aminoácidos/análise , Animais , Peptídeos Catiônicos Antimicrobianos/análise , Peptídeos Catiônicos Antimicrobianos/genética , Peptídeos Catiônicos Antimicrobianos/isolamento & purificação , Cromatografia Líquida de Alta Pressão , Primers do DNA , Feminino , Glicina/análise , Peptídeos/imunologia , Peptídeos/isolamento & purificação , Reação em Cadeia da Polimerase , Espectrometria de Massas por Ionização por Electrospray , Aranhas/imunologia , Aranhas/metabolismo
14.
Cell Mol Life Sci ; 67(15): 2643-51, 2010 Aug.
Artigo em Inglês | MEDLINE | ID: mdl-20358249

RESUMO

Defensins are a major family of antimicrobial peptides found throughout the phylogenetic tree. From the spider species: Cupiennius salei, Phoneutria reidyi, Polybetes pythagoricus, Tegenaria atrica, and Meta menardi, defensins belonging to the 'ancestral' class of invertebrate defensins were cloned and sequenced. The deduced amino acid sequences contain the characteristic six cysteines of this class of defensins and reveal precursors of 60 or 61 amino acid residues. The mature peptides consist of 37 amino acid residues, showing up to 70% identities with tick and scorpion defensins. In C. salei, defensin mRNA was found to be constitutively expressed in hemocytes, ovaries, subesophageal nerve mass, hepatopancreas, and muscle tissue. This is the first report presenting and comparing antimicrobial peptides belonging to the family of defensins from spiders.


Assuntos
Anti-Infecciosos , Defensinas , Sequência de Aminoácidos , Animais , Sequência de Bases , Defensinas/química , Defensinas/genética , Defensinas/metabolismo , Hemócitos/metabolismo , Peptídeos/genética , Aranhas/genética , Aranhas/metabolismo , Carrapatos/genética , Carrapatos/metabolismo
15.
Neuropharmacology ; 52(8): 1650-62, 2007 Jun.
Artigo em Inglês | MEDLINE | ID: mdl-17517422

RESUMO

The inhibitor cystine-knot motif identified in the structure of CSTX-1 from Cupiennius salei venom suggests that this toxin may act as a blocker of ion channels. Whole-cell patch-clamp experiments performed on cockroach neurons revealed that CSTX-1 produced a slow voltage-independent block of both mid/low- (M-LVA) and high-voltage-activated (HVA) insect Ca(v) channels. Since C. salei venom affects both insect as well as rodent species, we investigated whether Ca(v) channel currents of rat neurons are also inhibited by CSTX-1. CSTX-1 blocked rat neuronal L-type, but no other types of HVA Ca(v) channels, and failed to modulate LVA Ca(v) channel currents. Using neuroendocrine GH3 and GH4 cells, CSTX-1 produced a rapid voltage-independent block of L-type Ca(v) channel currents. The concentration-response curve was biphasic in GH4 neurons and the subnanomolar IC(50) values were at least 1000-fold lower than in GH3 cells. L-type Ca(v) channel currents of skeletal muscle myoballs and other voltage-gated ion currents of rat neurons, such as I(Na(v)) or I(K(v)) were not affected by CSTX-1. The high potency and selectivity of CSTX-1 for a subset of L-type channels in mammalian neurons may enable the toxin to be used as a molecular tool for the investigation of this family of Ca(v) channels.


Assuntos
Bloqueadores dos Canais de Cálcio/farmacologia , Canais de Cálcio Tipo L/efeitos dos fármacos , Canais de Cálcio Tipo L/fisiologia , Neurônios/efeitos dos fármacos , Venenos de Aranha/química , Venenos de Aranha/farmacologia , Animais , Animais Recém-Nascidos , Células Cultivadas , Baratas/citologia , Relação Dose-Resposta a Droga , Estimulação Elétrica/métodos , Gânglios Sensitivos/citologia , Potenciais da Membrana/efeitos dos fármacos , Camundongos , Nitrendipino/farmacologia , Técnicas de Patch-Clamp , Ratos
16.
Biochemistry ; 46(11): 3576-85, 2007 Mar 20.
Artigo em Inglês | MEDLINE | ID: mdl-17319697

RESUMO

The solution structure of cupiennin 1a, a 35 residue, basic antibacterial peptide isolated from the venom of the spider Cupiennius salei, has been determined by nuclear magnetic resonance (NMR) spectroscopy. The peptide was found to adopt a helix-hinge-helix structure in a membrane mimicking solvent. The hinge may play a role in allowing the amphipathic N-terminal helix and polar C-terminal helix to orient independently upon membrane binding, in order to achieve maximal antibacterial efficacy. Solid-state 31P and 2H NMR was used to further study the effects of cupiennin 1a on the dynamic properties of lipid membranes, using zwitterionic chain deuterated dimyristoylphosphatidylcholine (d54-DMPC) and anionic dimyristoylphosphatidylglycerol (DMPG) multilamellar vesicles. In d54-DMPC alone, cupiennin 1a caused a decrease in the 31P chemical shift anisotropy, indicating some interaction with the lipid head groups, and a decrease in order over the entire acyl chain. In contrast, for the mixed (d54-DMPC/DMPG) lipid system cupiennin 1a appeared to induce lateral separation of the two lipids as evidenced by the 31P spectra, in which the peptide preferentially interacted with DMPG. Little effect was observed on the deuterated acyl chain order parameters in the d54-DMPC/DMPG model membranes. Furthermore, 31P NMR relaxation measurements confirmed a differential effect on the lipid motions depending upon the membrane composition. Therefore, subtle differences are likely in the mechanism by which cupiennin 1a causes membrane lysis in either prokaryotic or eukaryotic cells, and may explain the specific spectrum of activity.


Assuntos
Bicamadas Lipídicas/química , Peptídeos/química , Venenos de Aranha/química , Sequência de Aminoácidos , Animais , Peptídeos Catiônicos Antimicrobianos , Dimiristoilfosfatidilcolina/química , Lipossomos/química , Dados de Sequência Molecular , Ressonância Magnética Nuclear Biomolecular , Fosfatidilgliceróis/química , Isótopos de Fósforo , Aranhas
17.
FEBS J ; 274(7): 1778-84, 2007 Apr.
Artigo em Inglês | MEDLINE | ID: mdl-17313650

RESUMO

Cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH2) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC50 concentration of 1.3 +/- 0.3 microM. This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15N-labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry.


Assuntos
Inibidores Enzimáticos/farmacologia , Óxido Nítrico Sintase Tipo I/antagonistas & inibidores , Óxido Nítrico/biossíntese , Peptídeos/farmacologia , Venenos de Aranha/farmacologia , Sequência de Aminoácidos , Animais , Peptídeos Catiônicos Antimicrobianos/química , Peptídeos Catiônicos Antimicrobianos/metabolismo , Peptídeos Catiônicos Antimicrobianos/farmacologia , Cálcio/química , Cálcio/metabolismo , Calmodulina/química , Calmodulina/metabolismo , Inibidores Enzimáticos/química , Inibidores Enzimáticos/metabolismo , Espectroscopia de Ressonância Magnética , Modelos Moleculares , Dados de Sequência Molecular , Óxido Nítrico Sintase Tipo I/química , Óxido Nítrico Sintase Tipo I/metabolismo , Peptídeos/química , Peptídeos/metabolismo , Ligação Proteica , Venenos de Aranha/química , Venenos de Aranha/metabolismo , Aranhas/química
18.
J Exp Biol ; 208(Pt 11): 2115-21, 2005 Jun.
Artigo em Inglês | MEDLINE | ID: mdl-15914655

RESUMO

Besides the power of the chelicerae, synergistic interactions between different components in the venom of Cupiennius salei ensure the hunting success of this spider. The main components of the venom were tested alone or in combination according to their physiological venom concentrations in Drosophila bioassays. The high K+ ion content of the venom synergistically increases the insecticidal activity of the neurotoxins CSTX-1, CSTX-9 and CSTX-13 by 20% but does not influence the insecticidal effectiveness of the antimicrobially and cytolytically acting cupiennin 1a. Histamine only enhances the activity of the main neurotoxin CSTX-1. An important role in the envenomation process is exhibited by cupiennin 1a, which increases the insecticidal activity of the above-mentioned neurotoxins by up to 65%. Additionally, the highly synergistic effect of the enhancer CSTX-13 on CSTX-1, provoked in non-toxic physiological concentrations, could be verified for CSTX-9, but not for cupiennin 1a. CSTX-1 and CSTX-9 show positive interactions only when both are injected in toxic non-physiological concentrations.


Assuntos
Neurotoxinas/toxicidade , Venenos de Aranha/química , Venenos de Aranha/toxicidade , Animais , Drosophila melanogaster , Sinergismo Farmacológico , Feminino , Dose Letal Mediana , Peso Molecular , Peptídeos/toxicidade
19.
J Biol Chem ; 277(13): 11208-16, 2002 Mar 29.
Artigo em Inglês | MEDLINE | ID: mdl-11792701

RESUMO

A new family of antimicrobial peptides was isolated from the venom of Cupiennius salei. The peptides were purified to homogeneity, and the sequence of cupiennin 1a was determined by Edman degradation: GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME-NH(2). The amino acid sequences of cupiennin 1b, c, and d were obtained by a combination of sequence analysis and mass spectrometric measurements of comparative tryptic peptide mapping. All peptides consist of 35 amino acid residues and are characterized by a more hydrophobic N-terminal chain region and a C terminus composed preferentially of polar and charged residues. The total charge of all cupiennins calculated under physiological conditions is +8, and their C terminus, formed by a glutamic acid residue, is amidated. Conformational studies of the peptides revealed a high helix forming potential. Antimicrobial assays on bacteria with cupiennin 1a, 1d, and synthesized cupiennins 1a* and 1d* showed minimal inhibitory concentrations for bacteria in the submicromolar range. Their lytic effect on human red blood cells was lower by a factor of 8 to 14 than the highly hemolytic melittin. Cupiennin 1a, 1b, 1d, 1a*, and 1d* showed pronounced insecticidal activity. The immediate biological effects and the structural properties of the isolated cupiennins indicate a membrane-destroying mode of action on prokaryotic as well as eukaryotic cells.


Assuntos
Antibacterianos/isolamento & purificação , Peptídeos , Venenos de Aranha/química , Venenos de Aranha/isolamento & purificação , Sequência de Aminoácidos , Animais , Antibacterianos/química , Antibacterianos/farmacologia , Peptídeos Catiônicos Antimicrobianos , Dicroísmo Circular , Eritrócitos/efeitos dos fármacos , Hemólise , Humanos , Dados de Sequência Molecular , Mapeamento de Peptídeos , Homologia de Sequência de Aminoácidos , Espectrometria de Massas por Ionização por Electrospray , Venenos de Aranha/farmacologia , Aranhas
SELEÇÃO DE REFERÊNCIAS
DETALHE DA PESQUISA