The Influence of Bee Venom Melittin on the Functioning of the Immune System and the Contractile Activity of the Insect Heart-A Preliminary Study.

Melittin (MEL) is a basic polypeptide originally purified from honeybee venom. MEL exhibits a broad spectrum of biological activity. However, almost all studies on MEL activity have been carried out on vertebrate models or cell lines. Recently, due to cheap breeding and the possibility of extrapolating the results of the research to vertebrates, insects have been used for various bioassays and comparative physiological studies. For these reasons, it is valuable to examine the influence of melittin on insect physiology. Here, for the first time, we report the immunotropic and cardiotropic effects of melittin on the beetle Tenebrio molitor as a model insect. After melittin injection at 10-7 M and 10-3 M, the number of apoptotic cells in the haemolymph increased in a dose-dependent manner. The pro-apoptotic action of MEL was likely compensated by increasing the total number of haemocytes. However, the injection of MEL did not cause any changes in the percent of phagocytic haemocytes or in the phenoloxidase activity. In an in vitro bioassay with a semi-isolated Tenebrio heart, MEL induced a slight chronotropic-positive effect only at a higher concentration (10-4 M). Preliminary results indicated that melittin exerts pleiotropic effects on the functioning of the immune system and the endogenous contractile activity of the heart. Some of the induced responses in T. molitor resemble the reactions observed in vertebrate models. Therefore, the T. molitor beetle may be a convenient invertebrate model organism for comparative physiological studies and for the identification of new properties and mechanisms of action of melittin and related compounds.

Peptide hormones regulate the physiological functions of reproductive organs in Tenebrio molitor males.

In insects, the majority of studies have been conducted on the hormonal regulation of female reproduction. Thus far, little is known about the regulation of male reproductive physiology, especially by peptide hormones. We report here, for the first time in insects, the effects of three peptides, Neb-colloostatin (SIVPLGLPVPIGPIVVGPR), Neb-TMOF (NPTNLH) and Lepde-NPF-I (ARGPQLRLRFa), on various aspects of reproduction in male Tenebrio molitor beetles. All three tested peptides increased the soluble protein concentration in the testes and the dry mass of the beetle's testes. They also significantly changed the protein profiles of the testes. Injection of these peptides also significantly changed the number of sperm cells in the testes. However, the observed effects were age specific. The most prominent changes were observed in 4-day-old males. Neb-colloostatin and Neb-TMOF decreased the number of sperm cells, whereas Lepde-NPF-I increased the number of spermatocytes. Moreover, in vitro experiments revealed that Neb-TMOF and Lepde-NPF-I increased the contractility of the ejaculatory duct of T. molitor males. The results obtained suggest that different reproductive processes in males might be regulated by complex mechanisms.

Efficacy of mealworm and super mealworm larvae probiotics as an alternative to antibiotics challenged orally with Salmonella and E. coli infection in broiler chicks.

This study was conducted to evaluate dry mealworm (Tenebrio molitor) (DMLP) and super mealworm (Zophobas morio) (DSMLP) larvae probiotics as alternatives to antibiotics in broiler chicks. A total of 240 one-day old Ross 308 male broiler chicks were randomly assigned to three dietary treatments consisting of ten replications with eight birds each in a completely randomized design. The dietary treatments were, (i) control (basal diet), (ii) 0.4% DMLP (basal diet + 0.4% DMLP, DM basis), and (iii) 0.4% DSMLP (basal diet + 0.4% DSMLP, DM basis). On day one, 1 mL of mixed broth agar consisting of 2.4 × 107 cfu Salmonella enteritidis KCTC 2021 and 3.7 × 107 cfu Escherichia coli KCTC 2571 was injected orally into each chick. After one week, growth performance, immunity, mortality, internal organ weight, and cecal and fecal microbiota were investigated. Average daily gain ( ADG: ) and average daily feed intake (ADFI) increased, while feed conversion ratio (FCR) (g intake/g gain per bird) decreased in response to DMLP and DSMLP supplementation (P < 0.05). Additionally, mortality decreased (P < 0.05), while IgG and IgA levels increased following DMLP and DSMLP supplementation (P < 0.05). Internal organs remained unaffected, except for a reduced bursa of Fabricius weight in DSMLP supplementation (P < 0.05). Cecal E. coli and Salmonella contents were reduced in DMLP and DSMLP supplementation (P < 0.05), while fecal microbiota contents and pH of cecal and fecal digesta remained unaffected. In conclusion, dietary supplementation with DMLP and DSMLP increased ADG and IgG and IgA levels, while reducing FCR, mortality and cecal E. coli and Salmonella spp. CONTENTS: Thus, DMLP and DSMLP can be utilized as an alternative to antibiotics in broiler diets.

Functional analysis of C1 family cysteine peptidases in the larval gut of Тenebrio molitor and Tribolium castaneum.

BACKGROUND: Larvae of the tenebrionids Tenebrio molitor and Tribolium castaneum have highly compartmentalized guts, with primarily cysteine peptidases in the acidic anterior midgut that contribute to the early stages of protein digestion. RESULTS: High throughput sequencing was used to quantify and characterize transcripts encoding cysteine peptidases from the C1 papain family in the gut of tenebrionid larvae. For T. castaneum, 25 genes and one questionable pseudogene encoding cysteine peptidases were identified, including 11 cathepsin L or L-like, 11 cathepsin B or B-like, and one each F, K, and O. The majority of transcript expression was from two cathepsin L genes on chromosome 10 (LOC659441 and LOC659502). For cathepsin B, the major expression was from genes on chromosome 3 (LOC663145 and LOC663117). Some transcripts were expressed at lower levels or not at all in the larval gut, including cathepsins F, K, and O. For T. molitor, there were 29 predicted cysteine peptidase genes, including 14 cathepsin L or L-like, 13 cathepsin B or B-like, and one each cathepsin O and F. One cathepsin L and one cathepsin B were also highly expressed, orthologous to those in T. castaneum. Peptidases lacking conservation in active site residues were identified in both insects, and sequence analysis of orthologs indicated that changes in these residues occurred prior to evolutionary divergence. Sequences from both insects have a high degree of variability in the substrate binding regions, consistent with the ability of these enzymes to degrade a variety of cereal seed storage proteins and inhibitors. Predicted cathepsin B peptidases from both insects included some with a shortened occluding loop without active site residues in the middle, apparently lacking exopeptidase activity and unique to tenebrionid insects. Docking of specific substrates with models of T. molitor cysteine peptidases indicated that some insect cathepsins B and L bind substrates with affinities similar to human cathepsin L, while others do not and have presumably different substrate specificity. CONCLUSIONS: These studies have refined our model of protein digestion in the larval gut of tenebrionid insects, and suggest genes that may be targeted by inhibitors or RNA interference for the control of cereal pests in storage areas.

Ecdysis triggering hormone signaling in arthropods.

Ecdysis triggering hormones (ETHs) from endocrine Inka cells initiate the ecdysis sequence through action on central neurons expressing ETH receptors (ETHR) in model moth and dipteran species. We used various biochemical, molecular and BLAST search techniques to detect these signaling molecules in representatives of diverse arthropods. Using peptide isolation from tracheal extracts, cDNA cloning or homology searches, we identified ETHs in a variety of hemimetabolous and holometabolous insects. Most insects produce two related ETHs, but only a single active peptide was isolated from the cricket and one peptide is encoded by the eth gene of the honeybee, parasitic wasp and aphid. Immunohistochemical staining with antiserum to Manduca PETH revealed Inka cells on tracheal surface of diverse insects. In spite of conserved ETH sequences, comparison of natural and the ETH-induced ecdysis sequence in the honeybee and beetle revealed considerable species-specific differences in pre-ecdysis and ecdysis behaviors. DNA sequences coding for putative ETHR were deduced from available genomes of several hemimetabolous and holometabolous insects. In all insects examined, the ethr gene encodes two subtypes of the receptor (ETHR-A and ETHR-B). Phylogenetic analysis showed that these receptors fall into a family of closely related GPCRs. We report for the first time the presence of putative ETHs and ETHRs in genomes of other arthropods, including the tick (Arachnida) and water flea (Crustacea). The possible source of ETH in ticks was detected in paired cells located in all pedal segments. Our results provide further evidence of structural and functional conservation of ETH-ETHR signaling.

Populational fluctuation and spatial distribution of Alphitobius diaperinus (Panzer) (Coleoptera; Tenebrionidae) in a poultry house, Cascavel, Parana state, Brazil

Knowledge of the population fluctuation and spatial distribution of pests is fundamental for establishing an appropriate control method. The population fluctuation and spatial distribution of the Alphitobius diaperinus in a poultry house in Cascavel, in the state of Parana, Brazil, was studied between October, 2001 and October 2002. Larvae and adults of the lesser mealworm were sampled weekly using Arends tube traps (n = 22) for six consecutive flock grow-outs. The temperature of the litter and of the poultry house was measured at the same locations of the tube traps. Beetle numbers increased continuously throughout all the sampling dates (average 5,137 in the first week and 18,494 insects on the sixth week). Significantly greater numbers of larvae were collected than adults (1 to 20 times in 95 percent of the sampling points). There was no correlation between temperature and the number of larvae and adults collected, therefore no fluctuation was observed during the sampling period. The population growth was correlated to litter re-use. The highest temperatures were observed in deep litter. The spatial distribution of larvae and adults in the poultry house was heterogeneous during the whole period of evaluation. Results suggest that monitoring in poultry houses is necessary prior to adopting and evaluating control measures due to the great variability of the insect distribution in the poultry house.

O conhecimento da flutuação populacional e distribuição espacial de pragas são fundamentais para o estabelecimento de uma metodologia de controle adequada. A flutuação populacional e distribuição espacial de Alphitobius -diaperinus em aviário de corte, localizado em Cascavel, Paraná foi avaliada no período entre outubro/2001 e Outubro/2002. Larvas e adultos do cascudinho foram coletados semanalmente com armadilhas de Arends (n = 22) em seis lotes de frangos, consecutivamente. A temperatura da cama foi medida nos locais onde as armadilhas foram expostas, bem como a temperatura no interior do galpão do aviário. O número de besouros aumentou continuamente em todas as áreas do aviário no decorrer das semanas de coleta (média de 5.137, na primeira semana, e de 18.494 insetos, na sexta semana). O número de larvas coletadas foi significantemente maior que o número de adultos (de 1 a 20 vezes em 95 por cento do total de coletas realizadas). Não houve correlação entre as variações de temperatura do galpão e da cama e o número de insetos coletados, não sendo, portanto, observada flutuação populacional ao longo do período de avaliação. O crescimento da população esteve relacionado ao acúmulo de camas, observando-se temperaturas mais altas em locais onde a cama era mais profunda. A distribuição espacial de larvas e adultos no galpão foi desuniforme com relação aos locais de coleta. Com base nos resultados obtidos, sugere-se que há necessidade de monitoramento dos aviários individualmente antes do emprego de qualquer medida de controle, devido à grande variabilidade na distribuição dos insetos em um único galpão de criação.

Variations of the antioxidant system during development of the cold-tolerant beetle, Tenebrio molitor.

Data relating to the peculiarities of antioxidant enzyme activities, glutathione (GSH) level and lipid peroxidation (LP) intermediates specific to at each ontogenic stage of Tenebrio molitor are presented. Metamorphosis is accompanied by a shift of prooxidant-antioxidant balance towards oxidative processes, since pupae have the highest levels of lipid peroxidation intermediates. Cold acclimation (4 degree C) can promote oxidative stress at the cold sensitive developmental stage--imagoes, which enhance their levels of diene conjugates and ketodienes after a 2-week cold acclimation. This enhancement is accompanied by an increase in catalase (CAT) activity. GSH levels undergo no changes in imagoes after cold acclimation. Neither larval nor pupal T. molitor show significant changes in LP product contents after cold acclimation. Chilling results in a significant increase in CAT activities in pupae, but not in larvae. GSH levels are reduced both in larvae and pupae after cold exposure. However, cold acclimation does not affect superoxide dismutase (SOD) activity in any of the developmental stages of T. molitor.

The effect of Hymenolepis diminuta (Cestoda) cysticercoids on the weight change, frass production, and food intake of the intermediate host, Tenebrio molitor (Coleoptera).

Parasitism results in nutritionally related changes in hosts, often leading to altered feeding behavior. Infected hosts that increase their feeding also increase their probability of reinfection. To study this, I used a beetle (Tenebrio molitor)-tapeworm (Hymenolepis diminuta) system. Infected and uninfected male and female beetles were individually housed in vials with food. Each beetle's weight change, food intake, and frass production were measured over 24-h periods at 3, 7, 12, and 16 days postinfection. Treatment (infection) had no effect on weight change, but males lost more weight and produced more frass than females. Additionally, treatment had no effect on food consumption, but males had a higher food intake than females. These results suggest that infection status will not alter the probability of reinfection, but males will be more susceptible to infection than females. However, despite the male's greater food intake during the experimental infection period, parasite loads did not differ between males and females.

The cathepsin L-like proteinases from the midgut of Tenebrio molitor larvae: sequence, properties, immunocytochemical localization and function.

CDNAs coding for five procathepsin L-like proteinases (pCALs) were cloned and sequenced from a cDNA library prepared from Tenebrio molitor larval midguts: pCAL1a (with the isoforms pCAL1b and pCAL1c), pCAL2, and pCAL3. All the pCALs have the active residues Cys 25, His 169, Asn 175, and Gln 19 (papain numbering), the ERFNIN motif of papain-like enzymes and their sequences are homologous to cathepsin L enzymes. pCAL1a was expressed in bacterial systems. It is auto-catalytically activated at low pH, has kinetic properties and N-terminal sequence identical to hemocyte cathepsin L-like proteinase (CAL) and was used to raise antibodies. Semi-quantitative RT-PCR data showed that mRNAs for pCAL2 and pCAL3 were transcribed in midgut and in lesser amounts in hemolymph, whereas that for pCAL1a was transcribed in these tissues and also in fat body, Malpighian tubules, and carcass. Imunochemical detection recognized pCAL1a translation in all tissue homogenates, except anterior midgut. At this region, the presence of pCAL2 is suggested on the grounds of electrophoretical migration and high recovery of CAL2 activity from anterior midgut cells and from isolated midgut contents. Immunocytochemical localization data revealed that pCAL1a occurs in lysosome-like vesicles in all tissues, except anterior midgut, where a labelling considered to correspond to pCAL2 is found in large acidic granules being released by apocrine secretion. Putative pCAL2 was also detected in midgut contents, probably in the form of CAL2, the major luminal CAL, which was purified to homogeneity. A cladogram of insect CALs result in a monophyletic branch with lysosomal T. molitor enzymes and enzymes from five insect orders and in a polyphyletic array of coleopteran sequences, including digestive CALs from T. molitor. The data suggest that only Coleoptera have digestive CALs that may originate by gene duplication and independent evolution relative to the gene encoding the lysosomal enzyme.

In vitro effects of RH-0345 and KK-42 on ecdysteroid levels and cuticle synthesis by pupal integument of mealworms.

In this study, the effects of two insect growth regulators (KK-42 and RH-0345), applied either alone or in combination, were evaluated on the ecdysteroid production in vitro. Integument explants from the abdominal sternites of newly ecdysed pupae of mealworms, Tenebrio molitor, were cultured and the amounts of ecdysteroids, released into the culture medium, were determined by an enzyme immunoassay (EIA) after various intervals of incubation. In combined treatments, explants were cultured for the first two days in a medium added with the first compound and then transferred in new medium containing the second compound. EIA measurements showed that RH-0345, either alone or followed by KK-42, resulted in higher amounts of ecdysteroids as compared to controls. In contrast, KK-42 alone caused a significant reduction. But, when KK-42 was followed by RH-0345, the ecdysteroid amounts were equal to controls. In another series of experiments, the effects on cuticle secretion were examined. Only in the case that explants were treated with RH-0345, either alone or followed by KK-42, new cuticle synthesis was observed.

The effects of endogenous diuretic and antidiuretic peptides and their second messengers in the Malpighian tubules of Tenebrio molitor: an electrophysiological study.

The Malpighian tubules of Tenebrio molitor provide a model system for interpreting the actions of endogenous diuretic and antidiuretic peptides. The effects of diuretic (Tenmo-DH(37)) and antidiuretic (Tenmo-ADFa) peptides and their respective second messengers (cyclic AMP and cyclic GMP) on basolateral (V(bl)) and transepithelial (V(te)) potentials of Tenebrio Malpighian tubules were determined using conventional microelectrodes. In the presence of 6 mmol l(-1) Ba(2+), Tenmo-DH(37) (100 nmol l(-1)) reversibly hyperpolarized V(bl) and depolarized V(te). A similar response was seen with the addition of 1 mmol l(-1) cyclic AMP; however, the apical membrane potential (V(ap)) then showed a hyperpolarization, whereas a depolarization of V(ap) was observed with Tenmo-DH(37). Bafilomycin A(1) (5 micromol l(-1)) inhibited fluid secretion of stimulated tubules and reversed the hyperpolarization of V(bl) in response to Tenmo-DH(37). In response to 100 nmol l(-1) Tenmo-ADFa or 1 mmol l(-1) cyclic GMP, V(bl) and V(te) depolarized, although cyclic GMP affected membrane potentials somewhat differently by causing an initial hyperpolarization of V(bl) and V(te). In high [K(+)]-low [Na(+)] Ringer, 1 mmol l(-1) amiloride decreased fluid secretion rates, and depolarized both V(bl) and V(te). Amiloride significantly decreased luminal pH in paired experiments, indicating the presence of a K(+)/nH(+) exchanger in tubule cells of Tenebrio. The results suggest that the endogenous factors and their second messengers stimulate/inhibit fluid secretion by acting on the apical V-ATPase, basolateral K(+) transport, and possibly Cl(-) transport.

K(+) transport in Malpighian tubules of Tenebrio molitor L: is a K(ATP) channel involved?

The presence of ATP-regulated K(+) (K(ATP)) channels in Tenebrio molitor Malpighian tubules was investigated by examining the effect of glibenclamide on both fluid secretion and basolateral membrane potentials (V(bl)). Glibenclamide, a K(ATP) channel blocker, slowed fluid secretion of Tenebrio tubules. In low bath K(+) concentration (5 mmol l(-1)), glibenclamide either hyperpolarized or depolarized V(bl), resembling the effect seen with Ba(2+). Subsequent addition of 6 mmol l(-1) Ba(2+) caused a further hyper- or depolarization of V(bl). In control Ringer (50 mmol l(-1) KCl, 90 mmol l(-1) NaCl), glibenclamide had no visible effect on V(bl). The effect of ouabain was investigated in low bath [K(+)] in the presence of Ba(2+). V(bl) responded by a small but significant hyperpolarization from -51+/-4 mV to -56+/-4 mV (n=16, P<0.001) in response to 1 mmol l(-1) ouabain. Repeating the experiments in the presence of both glibenclamide and Ba(2+) resulted in a depolarization of V(bl) when ouabain was added. In low bath [K(+)] (high Na(+)), the Na(+)/K(+)-ATPase is expected to function at a high rate. In the presence of Ba(2+), replacing Na(+) by K(+) rapidly depolarized V(bl), but this was followed by a repolarization. Repeating the experiments in the presence of glibenclamide markedly reduced the depolarizing effect and abolished the repolarization, with a gradual decrease in the sensitivity of V(bl) to the surrounding [K(+)]. These results suggest the presence of K(ATP) channels in the basolateral membrane. Glibenclamide had no visible effect on V(bl) in high K(+) or in the absence of Ba(2+), indicating that other highly conductive K(+) channels may mask the effect on K(ATP) channels. This is the first demonstration of the presence of K(ATP) channels in an insect epithelium.

Antagonistic control of fluid secretion by the Malpighian tubules of Tenebrio molitor: effects of diuretic and antidiuretic peptides and their second messengers.

Fluid secretion by insect Malpighian tubules is controlled by haemolymph-borne factors. The mealworm Tenebrio molitor provides the first known example of antagonistic interactions between endogenous neuropeptides acting on Malpighian tubules. The two corticotropin-releasing-factor (CRF)-related diuretic peptides previously isolated from Tenebrio molitor, Tenmo-DH(37) and Tenmo-DH(47), were found to stimulate Tenebrio molitor tubules in vitro in a dose-dependent manner with EC(50) values of 0.12 nmol l(-1) and 26 nmol l(-1) respectively. However, no synergistic or additive effect was observed when these two peptides were tested simultaneously. We then investigated antagonism between second messengers: dose-response curves were constructed for stimulation of Tenebrio molitor tubules by cyclic AMP and their inhibition by cyclic GMP. When both cyclic nucleotides were included in the bathing Ringer, the stimulatory effect of cyclic AMP was neutralised by cyclic GMP. Similarly, the stimulatory effect of Tenmo-DH(37) was reversed on addition of an antidiuretic peptide (Tenmo-ADF), which was recently isolated from Tenebrio molitor and acts via cyclic GMP. The cardioacceleratory peptide CAP(2b), originally isolated from Manduca sexta, also increases intracellular cyclic GMP levels and inhibited fluid secretion by Tenebrio molitor tubules, with an EC(50) value of 85 nmol l(-1). This inhibitory effect was reversed by Tenmo-DH(37). Endogenous diuretic and antidiuretic peptides, effective at low concentrations and acting via antagonistic second messengers, have the potential for fine control of secretion rates in the Malpighian tubules of Tenebrio molitor.

Density-dependent prophylaxis in the mealworm beetle Tenebrio molitor L. (Coleoptera: Tenebrionidae): cuticular melanization is an indicator of investment in immunity.

If there are costs involved with the maintenance of pathogen resistance, then higher investment in this trait is expected when the risk of pathogenesis is high. One situation in which the risk of pathogenesis is elevated is at increased conspecific density. This paper reports the results of a study of density-dependent polyphenism in pathogen resistance and immune function in the mealworm beetle Tenebrio molitor. Beetles reared at high larval densities showed lower mortality when exposed to a generalist entomopathogenic fungus and a higher degree of cuticular melanization than those reared solitarily. The degree of cuticular melanization was a strong indicator of resistance, with darker beetles being more resistant than lighter ones regardless of rearing density. No differences were found between rearing densities in the levels of phenoloxidase, an enzyme key to the insect immune response. The results show that pathogen resistance is phenotypically plastic in T. molitor, suggesting that the maintenance of this trait is costly.

Is tubulin the sole antigen recognized by a putative anti-bursicon antibody?

A 56-kDa polypeptide suspected to be the tanning hormone 'bursicon' was analyzed using the monoclonal antibody (mAb) 01C10 of Song and Ma. We studied the beetle Tenebrio molitor, for which data on bursicon have been recently published. After purification by two-dimensional gel electrophoresis of brain proteins, the immunoreactive 56-kDa polypeptide was trypsinated and microsequenced. The obtained sequences revealed a high homology with alpha- and beta-tubulins. In a complementary study, immunoreactive clones were isolated, using the 01C10 mAb, from a library in expression vector obtained from Drosophila melanogaster head cDNAs. Again, the isolated clones were found, after cDNA sequencing, to correspond to tubulin. Our results suggest that, although the 01C10 mAb could possibly still have a great affinity for a polypeptide present in very low quantities in a few brain neurosecretory cells, it also proved to have an artefactual affinity for a 56-kDa polypeptide, identified as tubulin, which is not involved in tanning control.

Impairment of the chemical defence of the beetle, Tenebrio molitor, by metacestodes (cysticeroids) of the tapeworm, Hymenolepis diminuta.

The defensive glands of beetles, Tenebrio molitor, infected with metacestodes (cysticercoids) of Hymenolepis diminuta are everted less frequently upon stimulation, and contain less toluquinone (methylbenzoquinone) and m-cresol, than glands of uninfected controls. These differences, as shown in predation trials with wild rats, increase the likelihood that both cysticercoids and beetles will be ingested by the tapeworm's definitive host. This is the first documented case of a parasite inhibiting the chemical defence of an intermediate host, and one of only a few reports of parasite-induced manipulation of host biology supported by empirical evidence implicating facilitated parasite transmission between host species.

Isolation and identification of a diuretic hormone from the mealworm Tenebrio molitor.

A diuretic hormone of unusual structure was isolated from extracts of whole heads of the mealworm Tenebrio molitor. The hormone is a 37-aa peptide of 4371 Da, with the sequence SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN. This peptide increases cAMP production in Malpighian tubules of T. molitor. The amino acid sequence reveals that this peptide is a member of the family of sauvagine/corticotropin-releasing factor/urotensin I-related insect diuretic hormones. The C-terminal sequence of this peptide is quite different from other members of this family, which have a hydrophobic C terminus (isoleucinamide or valinamide). When aligned comparably, T. molitor diuretic hormone has a more hydrophilic C terminus, leucylasparagine (free acid). In contrast to all other known diuretic hormones of this family, this peptide has exceptionally low stimulatory activity on cAMP production in Malpighian tubules of Manduca sexta. However, at nanomolar concentrations it stimulates cAMP production in Malpighian tubules of T. molitor. Diuretic hormones of this family have been isolated previously from Lepidoptera, Orthoptera, Dictyoptera, and Diptera. This appears to be the first diuretic hormone isolated from a coleopteran insect.

Increased coprophagic activity of the beetle, Tenebrio molitor, on feces containing eggs of the tapeworm, Hymenolepis diminuta.

When provided with fecal pellets from uninfected (control) rats and rats infected with the tapeworm Hymenolepis diminuta, more fed and starved (72 h) female and starved male Tenebrio molitor fed on fecal pellets from infected- than from control rats; compared to fecal pellets from controls rats, fed males avoided the infective fecal pellets. Uninfective and infective fecal pellets had similar moisture contents, so increased coprophagic activity was not due to differences in moisture content. Fed and starved males and females were fed on fecal pellets containing tapeworm eggs and examined for cysticercoids. Significantly greater numbers of starved beetles than fed beetles were infected with cysticercoids, but the numbers of infected males and females within each treatment were not significantly different. On the other hand, males contained significantly greater numbers of cysticercoids than did females, and there was no significant difference between the numbers of cysticercoids recovered from fed and starved beetles. The data support the hypothesis that the feeding behavior of T. molitor on rat feces is altered by the presence of tapeworm eggs. The data demonstrated further that transmission dynamics are affected by a complex interaction of the beetle's sex and nutritional status.

Ordered flow of secretion from accessory glands to specific layers of the spermatophore of mealworm beetles: demonstration with a monoclonal antibody.

Monoclonal antibodies were produced against the secretory product of the bean-shaped accessory gland (BAG) of male mealworm beetles (Tenebrio molitor). Antibodies from one clone (PL 6.3) recognized a 9,600 dalton protein with a pI of 6.6 which was found in homogenates of the BAG. The PL 6.3 antigen was first detected on Western blots of BAG proteins from 2-day adults, and amounts increased for the next 6 days until reproductive maturation was achieved. The antibody also recognized a polypeptide with a molecular weight (mw) of about 5,000 daltons which we believe to be derived from the larger 9,600 dalton antigen. There are eight types of secretory cells in the BAG. By using light microscopic immunohistochemistry, we localized the antigens recognized by PL 6.3 in cell type 7 (intense staining) and cell type 5 (weak staining). Results from electron microscopic immunocytochemistry showed that antigen PL 6.3 was concentrated in the secretory granules characteristic of each of these two cell types and was absent in all other cell types. PL 6.3 antigens were traced from the BAG into its secretory product and then into the prespermatophoric mass in the ejaculatory duct. The antigen was not randomly mixed with other secretory products of the accessory glands. As it flowed from the BAG and into the ejaculatory duct, it remained in a coherent, precisely localized mass. Within the definitive spermatophore, the PL 6.3 antigen was concentrated in discrete layers of material that line the lumen.

Postsynaptic effects of nickel ions at the insect neuromuscular junction.

The effect of extracellular nickel on the excitatory postsynaptic response at the insect neuromuscular junction was studied in the segmental muscle of the larval mealworm Tenebrio molitor. The response to L-glutamate applied iontophoretically (glutamate potential, GP) was potentiated in the presence of Ni2+ though the excitatory postsynaptic potential (EPSP) was reduced. It seems unlikely that Ni2+ acts at the same binding site as L-glutamate does since the value of the limiting slope of double logarithmic plots for the action of glutamate was increased in the presence of Ni2+. The potentiation of GP in the presence of Ni2+ cannot be ascribed to competition between Ni2+ and Ca2+ since GP amplitude did not show any dependence on the concentration of Ca2+. Nickel ions did not alter the reversal potential of excitatory postsynaptic current (EPSC) and glutamate current (GC) under the voltage clamp condition, whereas the amplitude of GC was potentiated in the presence of Ni2+. The time constant of the decay of EPSC showed a weak voltage dependency: the more depolarized the membrane, the more prolonged the time constant. In the presence of 1 mM Ni2+ the amplitude of miniature EPSCs (MEPSCs) increased and the half decay time was prolonged significantly. These results suggest that Ni2+ interacts with charged groups near the glutamate receptor-channel complex so that the kinetics of the channel are altered.