Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 52
Filtrar
Mais filtros

Bases de dados
Tipo de documento
Intervalo de ano de publicação
1.
Biochim Biophys Acta ; 453(1): 121-32, 1976 Nov 26.
Artigo em Inglês | MEDLINE | ID: mdl-999876

RESUMO

alpha-Neurotoxin from Naja nigricollis and erabutoxin b from Laticauda semifasciata, two homologous neurotoxic proteins, are studied by circular dichroism, ultraviolet spectroscopy and fluorescence in various water/trifluoroethanol mixtures. The data obtained show that the beta structure of alpha-neurotoxin is conserved in water as well as in the organic solvent. By contrast, erabutoxin b changes from the beta-structure in water to the helix type in trifluoroethanol. The latter induces similarly for both toxins a structural modification around tryptophan 29, a residue common to all neurotoxins known to date. The vicinity of tyrosine 25, another common amino acid, is also altered by the presence of the organic solvent as demonstrated by the sudden increase of reactivity of the phenolic ring towards iodine. The present work affords some evidence for the presence of a particular structure located around the two aromatic residues, which is common to all neurotoxins and able to rearrange independently from the rest of the molecule. Biological importance of this peculiar region is highly probable.


Assuntos
Venenos de Serpentes , Toxinas Biológicas , Animais , Dicroísmo Circular , Dissulfetos/análise , Ligação Proteica , Conformação Proteica , Espectrofotometria Ultravioleta , Tirosina/análise
2.
Leukemia ; 11(1): 31-6, 1997 Jan.
Artigo em Inglês | MEDLINE | ID: mdl-9001415

RESUMO

Polyamines have been implicated to play a role in cell proliferation and in cancer development. Ninety percent of the circulating spermidine (Spd) and spermine (Spm) are transported by red blood cells (RBC). RBC Spd and Spm levels were prospectively determined in 63 unselected children with common acute lymphoblastic leukemia. The Spm and Spd levels were not correlated with white blood cell (WBC) count. On the basis of the polyamine levels it was possible to discriminate four groups with P< 10(-3). In C1, C2, C3 and C4 group the Spm level was respectively 90 (39-597), 3.75 (1-7.45), 9.95 (2.9-12.6) and 17(6.3-33.8). The probability of relapse-free survival (RFS) of the 58 children who entered complete remission was 55% +/- 9. For the groups C1 (n = 6), C2 (n = 16), C3 (n = 21) and C4 (n= 15) groups, the RFS was 25% +/- 20, 73% +/- 12, 73% +/- 13 and 32% +/- 13 respectively. For children with Spm levels <13/> or = 13nmol/8 x 10(9) RBC, event-free survival (EFS) was 54% +/- 11/33% +/- 10 and RFS was 64% +/- 12/38% +/- 11 respectively (P < 0.03, P < 0.005). Our clinical study shows clearly that an RBC spermine level could be used as parameter of prognosis at the time of diagnosis, particularly for patients with intermediary WBC count.


Assuntos
Eritrócitos/química , Proteínas de Neoplasias/sangue , Leucemia-Linfoma Linfoblástico de Células Precursoras/sangue , Espermidina/sangue , Espermina/sangue , Adolescente , Criança , Pré-Escolar , Intervalo Livre de Doença , Feminino , Humanos , Lactente , Contagem de Leucócitos , Masculino , Leucemia-Linfoma Linfoblástico de Células Precursoras/classificação , Probabilidade , Prognóstico , Estudos Prospectivos , Sensibilidade e Especificidade
3.
FEBS Lett ; 347(1): 31-6, 1994 Jun 20.
Artigo em Inglês | MEDLINE | ID: mdl-8013656

RESUMO

Cyclophilin-B (bCyP-20) was isolated in a relatively high quantity from calf brain and spleen tissues consecutively applying weak cation exchange, chromatofocusing and strong cation exchange chromatographies. Edman degradation yielded the N-terminal sequence NH2-DEKKKGPKVTVK- VYFDLRIGDEDIGRVVIGLFGKTVPKTVDNFVAL. Bovine cyclophilin-B possesses the peptidylproline cis-trans isomerase activity which is inhibited by nM concentrations of CsA. bCyP-20 has a strong tendency to bind to cation exchangers including DNA and heparin. It could be released from DNA affinity column at concentrations of NaCl higher than 200 mM. Circular dichroism spectroscopy revealed that bovine cyclophilin-A (bCyP-18) and bCyP-20 in aqueous solution have similar conformations.


Assuntos
Isomerases de Aminoácido/química , Proteínas de Transporte/química , Ciclofilinas , Isomerases de Aminoácido/isolamento & purificação , Sequência de Aminoácidos , Aminoácidos/análise , Animais , Química Encefálica , Proteínas de Transporte/isolamento & purificação , Bovinos , Dicroísmo Circular , Eletroforese em Gel Bidimensional , Dados de Sequência Molecular , Peptidilprolil Isomerase , Conformação Proteica , Análise de Sequência , Homologia de Sequência de Aminoácidos , Baço/química
4.
FEBS Lett ; 319(3): 233-6, 1993 Mar 22.
Artigo em Inglês | MEDLINE | ID: mdl-8458415

RESUMO

Two isoforms of the macrophage migration inhibitory factor (MIF) have been isolated to homogeneity from bovine brain cytosol. In agreement with the cDNA sequence of their human counterpart, they both have an apparent molecular weight of 12 kDa and are characterized by the following N-terminal amino acid sequence NH2-PMFVVNTNVPRASVPDGLLSELTQQLAQATGKPPQYIAV-. CD spectra revealed that bovine MIF contains 42% (+/- 3%) alpha-helix and 21% (+/- 3%) beta-structure. CD-constrained prediction of the secondary structure assigned MIF to the alpha/beta-class of proteins.


Assuntos
Fatores Inibidores da Migração de Macrófagos/isolamento & purificação , Sequência de Aminoácidos , Animais , Química Encefálica , Bovinos , Dicroísmo Circular , Citosol/química , Humanos , Concentração de Íons de Hidrogênio , Fatores Inibidores da Migração de Macrófagos/genética , Dados de Sequência Molecular , Peso Molecular , Alinhamento de Sequência
5.
FEBS Lett ; 261(2): 226-30, 1990 Feb 26.
Artigo em Inglês | MEDLINE | ID: mdl-2155818

RESUMO

Venom of the Australian tiger snake, Notechis scutatus scutatus was fractionated by conventional ion-exchange chromatography. The fraction containing notexin, a well-known single-chain toxic phospholipase A2, was further purified by reverse-phase high-performance liquid chromatography. Two main components were isolated and the major one corresponded to notexin. The other component, designated as notechis Ns, was an isoform of notexin. Notechis Ns and notexin possessed similar in vitro esterase activity, in vitro neuromuscular activity and in vivo lethality. Amino acid composition and sequence of the Staphylococcus aureus V8-protease peptides demonstrated that primary structures of notechis Ns and notexin differed from each other by a single substitution amongst 119 amino acids: Lys----Arg at position 16.


Assuntos
Venenos Elapídicos/isolamento & purificação , Sequência de Aminoácidos , Animais , Bioensaio , Galinhas , Cromatografia Líquida de Alta Pressão , Cromatografia por Troca Iônica , Venenos Elapídicos/farmacologia , Venenos Elapídicos/toxicidade , Esterases/metabolismo , Feminino , Hidrólise , Dose Letal Mediana , Camundongos , Camundongos Endogâmicos BALB C , Dados de Sequência Molecular , Junção Neuromuscular/efeitos dos fármacos , Junção Neuromuscular/fisiologia , Fragmentos de Peptídeos , Rana pipiens , Transmissão Sináptica/efeitos dos fármacos
6.
FEBS Lett ; 292(1-2): 249-53, 1991 Nov 04.
Artigo em Inglês | MEDLINE | ID: mdl-1959613

RESUMO

Two derivatives of alpha-toxin from Naja nigricollis venom were used in order to study, by resonance Raman spectroscopy, its interaction with the nicotinic acetylcholine (AcCho) receptor from membranes of Torpedo marmorata electrocytes. The two modified toxins carry either an NO2 group bound to Tyr25 or a nitrophenylthioether (NPS) bound to Trp29. The comparison of the spectra of the free and bound derivatized toxins indicates that the environment of Tyr25 is not perturbed upon binding to the AcCho receptor; but the surroundings of NPS bound to Trp29 are changed. This result indicates that Tyr25 is not involved in binding, while Trp29 of the alpha-toxin may be in contact with the AcCho receptor. Examination of the spectrum of the AcCho receptor membrane after binding of the NPS-Trp toxin discloses some modifications of the vibrations of the tryptophan and cysteine disulfide bridge of the receptor. These residues are possibly involved in toxin binding.


Assuntos
Venenos Elapídicos/química , Neurotoxinas/metabolismo , Receptores Nicotínicos/química , Animais , Análise Espectral Raman , Torpedo
7.
Biochimie ; 77(4): 233-9, 1995.
Artigo em Inglês | MEDLINE | ID: mdl-8589050

RESUMO

The effects of various concentrations of 2-fluoro-2-deoxy-D-glucose (FDG) on the aerobic metabolism of glucose and the reciprocal effect of glucose on the metabolism of FDG in glucose-grown repressed Saccharomyces cerevisiae cells were studied at 30 degrees C in a standard pyrophosphate medium containing 5 x 10(7) cells/ml by 1H-, 19F-, 31P-NMR and biochemical techniques. The glucose consumption rate is reduced by about 57% and 71% in the presence of 5 mM FDG and 10 mM FDG respectively. Under the same conditions, the ethanol production rate also decreases about 54% and 68%, respectively. When FDG is the unique carbon source, the alpha- and beta-anomers of 2-fluoro-2-deoxy-D-glucose-6-phosphate (FDG6P) and a much smaller quantity of 2-fluoro-2-deoxy-gluconic acid (FDGA) were observed. The quantities of alpha- and beta-FDG6P reach their maximum values within 1 h of incubation and then decrease continuously. In contrast, Glc favors the consumption of FDG and the synthesis of FDG6P and uridine-5'-diphosphate fluorodeoxy-glucose (UDP-FDG). In the presence of Glc, FDG6P reaches a plateau after 1 h or 2 h of incubation while UDP-FDG increases regularly with time. Apart from trehalose, no other disaccharide such as fluoro-dideoxy-trehalose (FDG-FDG) or fluoro-deoxy-trehalose (FDG-Glc) were observed. Thus, in contrast to UDP-Glc, UDP-DG, Glc6P and DG6P, UDP-FDG and FDG6P are not good substrates for trehalose-6-P synthetase.(ABSTRACT TRUNCATED AT 250 WORDS)


Assuntos
Desoxiglucose/análogos & derivados , Glucose/metabolismo , Glucose/farmacologia , Espectroscopia de Ressonância Magnética/métodos , Saccharomyces cerevisiae/metabolismo , Divisão Celular/efeitos dos fármacos , Desoxiglucose/metabolismo , Desoxiglucose/farmacologia , Radioisótopos de Flúor , Fluordesoxiglucose F18 , Saccharomyces cerevisiae/efeitos dos fármacos
8.
Biochimie ; 63(6): 477-84, 1981 Jun.
Artigo em Francês | MEDLINE | ID: mdl-6266515

RESUMO

FK-33-824 (Try-D-Ala-Gly-MePhe-Met(O)ol) is a potent enkephalin analog which has been tritium labelled with a high specific radioactivity (41 Ci/mmole). The labelled drug exhibits specific and saturable binding to rat brain crude mitochondrial fraction. Specific binding is inhibited by low concentrations of morphine, levallorphan and beta-endorphin, suggesting that FK 33-824 [3H] binds preferentially to mu opiate sites. Binding studies at equilibrium and kinetics of formation and dissociation of the labelled ligand-receptor complex indicate that FK 33-824 [3H] binds to two classes of specific sites. Their affinities are distinguishable at 0 degree (KD = 1.3 and 5.8 nM) and very close to each other at 37 degree (KD = 1.9 nM).


Assuntos
Encéfalo/metabolismo , Endorfinas/metabolismo , Encefalinas/metabolismo , Mitocôndrias/metabolismo , Animais , D-Ala(2),MePhe(4),Met(0)-ol-encefalina , Endorfinas/farmacologia , Cinética , Levalorfano/farmacologia , Morfina/farmacologia , Papio , Ratos , beta-Endorfina
9.
Toxicon ; 32(11): 1433-43, 1994 Nov.
Artigo em Inglês | MEDLINE | ID: mdl-7533951

RESUMO

The scorpion venom Leiurus quinquestriatus hebreus was fractionated by chromatography in order to isolate toxins that affected binding of radiolabelled dendrotoxin to K+ channel proteins on synaptosomal membranes and that facilitated acetylcholine release in chick biventer cervicis nerve-muscle preparations. In addition to the previously characterized charybdotoxin, three toxins were isolated: 14-2, 15-1 and 18-2. Toxin 14-2 has a blocked N-terminus and because of low quantities, it has not been sequenced; 15-1 is a newly sequenced toxin of 36 residues with some overall homology to charybdotoxin and noxiustoxin; 18-2 is identical to charybdotoxin-2. The apparent Ki against dendrotoxin binding were: charybdotoxin, 3.8 nM; 14-2, 150 nM; 15-1, 50 nM; and 18-2, 0.25 nM. Toxin 14-2 (75 nM-1.5 microM) had a presynaptic facilitatory effect on neuromuscular preparations. Toxin 15-1 augmented responses to direct muscle stimulation, probably because it blocked Ca(2+)-activated K+ currents in muscle fibres. Toxin 18-2 (charybdotoxin-2) had a potent presynaptic facilitatory action, with less effect on direct muscle stimulation. This contrasts with the relatively weak neuromuscular effects of the highly homologous charybdotoxin. On a Ca(2+)-activated K+ current in mouse motor nerve endings, charybdotoxin and toxin 18-2 produced maximal block at around 100 nM, whereas 15-1 was inactive at 300 nM. Charybdotoxin can increase quantal content, but this is more likely to result from block of voltage-dependent K+ channels than Ca(2+)-activated channels: the increase in transmitter release occurred in conditions in which little IKCa would be present; higher concentration of charybdotoxin and longer exposure times were required to increase transmitter release than those needed to block IKCa, and the facilitatory effects of charybdotoxin and toxin 18-2 correlated more with their effects on dendrotoxin binding than on block of IKCa.


Assuntos
Junção Neuromuscular/efeitos dos fármacos , Neurotoxinas/toxicidade , Bloqueadores dos Canais de Potássio , Venenos de Escorpião/toxicidade , Acetilcolina/metabolismo , Sequência de Aminoácidos , Animais , Ligação Competitiva , Charibdotoxina , Fracionamento Químico , Galinhas , Cromatografia Líquida de Alta Pressão , Cromatografia por Troca Iônica , Relação Dose-Resposta a Droga , Venenos Elapídicos/isolamento & purificação , Venenos Elapídicos/metabolismo , Venenos Elapídicos/toxicidade , Técnicas In Vitro , Masculino , Camundongos , Dados de Sequência Molecular , Neurotoxinas/química , Neurotoxinas/isolamento & purificação , Neurotoxinas/metabolismo , Nervo Frênico/metabolismo , Canais de Potássio/metabolismo , Ensaio Radioligante , Venenos de Escorpião/química , Venenos de Escorpião/isolamento & purificação , Venenos de Escorpião/metabolismo , Homologia de Sequência de Aminoácidos , Relação Estrutura-Atividade , Sinaptossomos/efeitos dos fármacos , Sinaptossomos/metabolismo
10.
Anticancer Res ; 17(4A): 2411-8, 1997.
Artigo em Inglês | MEDLINE | ID: mdl-9252656

RESUMO

The copper complexes of furan oxime derivatives were found to be potent cytotoxic agents in both murine and human tissue cultured cell lines which were either suspended or solid tumors. The ED50 values were frequently improved over the clinically useful antineoplastic agents. These copper complexes of 2-furaldehyde oximes were effective inhibitors of L1210 lymphoid leukemia DNA synthesis followed by RNA synthesis. Purine synthesis regulatory enzyme activities were markedly reduced by the compounds with marginal inhibition of t-RNA polymerase, and nucleoside kinases activities. L1210 DNA topoisomerase II activity was markedly reduced with IC50 values better than the standard VP-16, etoposide. Yet, the copper complexes caused no further protein linked breaks than VP-16 did, but did block phosphorylation activation of the topoisomerase II enzyme.


Assuntos
Antineoplásicos/toxicidade , Cobre/química , Furaldeído/toxicidade , Células Tumorais Cultivadas/efeitos dos fármacos , Animais , Divisão Celular/efeitos dos fármacos , Sobrevivência Celular/efeitos dos fármacos , DNA de Neoplasias/metabolismo , Furaldeído/análogos & derivados , Humanos , Leucemia L1210 , Proteínas de Neoplasias/metabolismo , Oximas/toxicidade , Fatores de Tempo , Células Tumorais Cultivadas/citologia , Células Tumorais Cultivadas/metabolismo
11.
Anticancer Res ; 15(6B): 2517-22, 1995.
Artigo em Inglês | MEDLINE | ID: mdl-8669816

RESUMO

There have been numerous attempts in the past to use polyamine determinations in body fluids for tumour diagnosis. Since spermidine (Spd) and spermine (Spm) are mainly transported in blood by erythrocytes, this study was concerned with the diagnostic possibilities of red blood cell (RBC) polyamine determinations. In tumour-grafted animals we observed that RBC polyamine levels correlated with the tumour mass progression and increased before the tumour was palpable. Discrepancies between the evolution of RBC polyamine levels in tumour-grafted animals and in cancer patients were probably due to the non-continuous growth of the tumours in patients. Therefore, an animal model was sought which mimicked the clinical situation. In the present experiments, ethylnitrosourea induced tumours were used which, in analogy to the clinical situation, had an undetermined time of the appearance in a non-predetermined proportion of the animals. RBC polyamines were determined over a period of 7 months in 154 rats. A total of 2,290 RBC polyamine determinations were performed during this study. The data clearly demonstrate the appearance of elevated Spd concentrations in advance of tumour diagnosis by conventional clinical methods. In 71% of the rats which later developed a tumour, abnormal Spd levels (> 40 nmol/8.109 RBC) preceded, by 35 +/- 31 days, the first clinical symptoms for the presence of a tumour. In 29% of the animals, abnormal RBC Spd concentrations were observed at the time of tumour diagnosis. Elevation of Spm concentrations (> 6 nmol/8.10(9) RBC) was less frequent. RBC polyamine levels did not allow discrimination between malignant and non malignant tumours. This confirms earlier findings that RBC polyamines are markers of the cell proliferation rate, but not for the presence of a malignant tumour. Elevated RBC polyamine concentrations are an index of the intensity of hyperplastic processes, which can be clinically used for the early detection of proliferative phases of tumours, thus allowing timely therapeutic measures.


Assuntos
Biomarcadores Tumorais/sangue , Eritrócitos/química , Neoplasias Experimentais/sangue , Poliaminas/sangue , Animais , Carcinógenos/administração & dosagem , Progressão da Doença , Etilnitrosoureia/administração & dosagem , Feminino , Masculino , Transplante de Neoplasias , Neoplasias Experimentais/induzido quimicamente , Neoplasias Experimentais/diagnóstico , Valor Preditivo dos Testes , Gravidez , Efeitos Tardios da Exposição Pré-Natal , Ratos , Ratos Wistar , Espermidina/sangue , Espermina/sangue
12.
Anticancer Res ; 9(6): 1757-60, 1989.
Artigo em Inglês | MEDLINE | ID: mdl-2627126

RESUMO

Previous studies have shown that red blood cell (RBC) spermidine (Spd) and spermine (Spm) concentrations appear to be a reliable index of cell proliferation. Our aim was to study the RBC polyamine level evolution (Spd and Spm) in bone marrow (BM) transplanted children. Because of our interest in the finding of an early blood criteria of BM regeneration, our study was based upon the chemotherapy - induced post-transplant aplasia period. After BM transplantation, two main periods were observed: the first (A-period) corresponded to abnormally low Spd levels. This period ended with an increasing amount of Spd reaching normal values and with an inversion in the Spd/Spm ratio which became greater than 1. The second (B) period was usually linked to abnormally high RBC Spd concentrations and a Spd/Spm ratio greater than 1. The end of the B-period was characterized by an increase in the granulocyte count (reaching 0.5 X 10(9) cells/l). Since the A- and B-periods are considered as a post-transplant aplasia period (only according to leukocyte count) and since normal RBC Spd levels occurred 14 days (SD = 4) after BM transplantation and 16 days (SD = 12) before granulocyte rise, these data led us to consider erythrocyte polyamine levels to be an earlier biological criteria of bone marrow engraftment than the number of circulating granulocytes.


Assuntos
Biomarcadores/sangue , Transplante de Medula Óssea , Eritrócitos/análise , Leucemia Linfoide/cirurgia , Linfoma/cirurgia , Neuroblastoma/cirurgia , Espermidina/sangue , Espermina/sangue , Teratoma/cirurgia , Adolescente , Divisão Celular , Criança , Pré-Escolar , Feminino , Humanos , Lactente , Leucemia Linfoide/sangue , Linfoma/sangue , Masculino , Neuroblastoma/sangue , Valores de Referência , Teratoma/sangue , Transplante Autólogo , Transplante Homólogo
13.
Ann Biol Clin (Paris) ; 62(3): 257-68, 2004.
Artigo em Francês | MEDLINE | ID: mdl-15217758

RESUMO

Recent advances in the field of immunobiology have provided many opportunities for anticancer-immunotherapy. Because they express tu-mor antigen, tumor cells can be kill by T cells. Renal Cell Carcinoma (RCC) is an immunogenic tumor and metastatic RCC is presently treated by cytokines. Anticancer immunity may be achieved by different strategies: allogeneic hematopoietic cell transplantation, vaccination with peptides, vaccination with loaded dendritic cells or adoptive cellular therapy in which specific T cells are isolated and expanded in vitro and then infused to patients. In our group, we have chosen the adoptive transfer of in vitro activated T cells with autologous tumor antigen loaded dendritic cells. To determine the best strategy of anticancer-immunotherapy, we need rigorous control of the specificity and the phenotype of the cell therapy product linked with the immunological status of the patient (before and after infusion) and with the clinical response.


Assuntos
Carcinoma de Células Renais/imunologia , Carcinoma de Células Renais/terapia , Imunoterapia , Neoplasias Renais/imunologia , Neoplasias Renais/terapia , Ensaios Clínicos como Assunto , Humanos , Sistema Imunitário/fisiologia
15.
Biochem Biophys Res Commun ; 237(1): 46-51, 1997 Aug 08.
Artigo em Inglês | MEDLINE | ID: mdl-9266827

RESUMO

12 kDa subunit of glycosylation-inhibiting factor (GIF) is an abundant protein that can be isolated to homogeneity from different mammalian organs by successive application of the carboxymethylcellulose cation exchanger CM52, preparative flat-bed isoelectrofocusing and repeated application of CM52-cellulose. Several isoforms of the 12 kDa GIF subunit exist in mammalian tissues. Conformational stability of two isoforms of a 12 kDa porcine GIF subunit have been studied by CD. Conformation of the protein remains stable within the range 20 degrees to 60 degrees C. Over 60 degrees C the protein undergoes irreversible denaturation. The 12 kDa GIF subunit is not stable within the pH range 2 to 3, adopts quasi-native structure within the pH range 3.5 to 5 while it remains stable between the pHs 6 to 10. The 12 kDa GIF subunit strongly binds to CM52-cellulose from which it can be eluted at concentrations of NaCl higher than 0.6 M. The GIF subunit may also be eluted from the modified cellulose using certain glycoproteins and sugars. High abundance of the 12 kDa GIF subunit in different mammalian tissues and its capacity to bind certain glycoproteins and sugars may suggest that the protein might be involved in regulatory mechanisms of glycoprotein transport (chaperone for glycoproteins) and modulation of interactions between secreted glycoproteins and the cell surface receptors.


Assuntos
Encéfalo/metabolismo , Metabolismo dos Carboidratos , Glicoproteínas/metabolismo , Linfocinas/química , Linfocinas/metabolismo , Proteínas Secretadas pela Próstata , Sequência de Aminoácidos , Animais , Galinhas , Dicroísmo Circular , Eletroforese em Gel de Poliacrilamida , Glicosilação , Linfocinas/isolamento & purificação , Substâncias Macromoleculares , Mamíferos , Camundongos , Dados de Sequência Molecular , Conformação Proteica , Ratos , Alinhamento de Sequência , Homologia de Sequência de Aminoácidos , Suínos
16.
Electrophoresis ; 16(7): 1095-103, 1995 Jul.
Artigo em Inglês | MEDLINE | ID: mdl-7498153

RESUMO

A critical overview is given on the application of amino acid composition data for the establishment of the protein's identity (amino acids composition vs. protein identity, the AAC-PI method). Several criteria are used to measure the differences between the amino acid compositions of various proteins. The AAC-PI method unambiguously identifies proteins which belong to the families with a high phylogenetic conservancy of their sequences. The identification of pure proteins can be accomplished with a relatively high level of confidence. The AAC-PI method, however, sometimes needs the support of N-terminal or internal sequencing of proteins since, alone, it cannot distinguish whether the lack of finding a candidate protein in protein data bases is because the investigated amino acid composition corresponds to an unknown protein or its processed form or because it is a sum of at least two protein components, or whether it is due to other experimental errors. The identification of a few new proteins such as "arginine-rich protein", macrophage migration inhibitory factor (MIF) and the preformed neurotrophic factor present in the calf brain cytosol is also reported.


Assuntos
Algoritmos , Aminoácidos/análise , Proteínas/química , Sequência de Aminoácidos , Animais , Bovinos , Bases de Dados Factuais , Humanos , Dados de Sequência Molecular , Peso Molecular , Proteínas/isolamento & purificação , Solubilidade , Água/química
17.
C R Acad Hebd Seances Acad Sci D ; 285(16): 1527-30, 1977 Dec 19.
Artigo em Francês | MEDLINE | ID: mdl-148330

RESUMO

After breakage of their four disulfide bonds, snake curare-like toxins recover spontaneously their native conformation at different rates depending on the number of residues in the sequence.


Assuntos
Venenos Elapídicos , Sequência de Aminoácidos , Animais , Dissulfetos , Venenos Elapídicos/farmacologia , Fármacos Neuromusculares não Despolarizantes , Conformação Proteica , Desnaturação Proteica
18.
Eur J Biochem ; 224(2): 417-21, 1994 Sep 01.
Artigo em Inglês | MEDLINE | ID: mdl-7925355

RESUMO

Two isoforms of a bovine-brain-derived 12-kDa protein (designated p12a and p12b) whose N-termini have a high amino acid sequence similarity with the glycosylation-inhibiting factor (GIF) and macrophage migration-inhibitory factor (MIF) were purified to homogeneity. The complete amino acid sequence of bovine p12a (pI 9.5) was determined by Edman degradation of the intact molecule and overlapping fragments generated by proteolytic cleavage. The p12a isoform has nine and ten conservative substitutions versus human GIF (hGIF) and human MIF (hMIF), respectively. Molecular filtration revealed that both isoforms of p12 exist as monomers in aqueous solution. Circular dichroism spectra indicate that both isoforms of p12 consist of 39 +/- 3% alpha helix, 23 +/- 3% beta structure and 15 +/- 3% beta turns. Although the N-terminal parts of p12a and p12b have weak amino acid sequence similarity with that of glutathione S-transferase (GST) neither isoform of p12 was bound to a GST-affinity gel nor had GST activity. Despite a high amino acid sequence similarity with human MIF neither of the p12 isoforms inhibited migration of the mouse monocyte-macrophage cells P338D1.


Assuntos
Química Encefálica , Fatores Inibidores da Migração de Macrófagos/química , Proteínas do Tecido Nervoso/química , Sequência de Aminoácidos , Animais , Bovinos , Linhagem Celular , Dicroísmo Circular , Eletroforese em Gel de Poliacrilamida , Humanos , Macrófagos/química , Camundongos , Dados de Sequência Molecular , Peso Molecular , Proteínas do Tecido Nervoso/isolamento & purificação , Estrutura Secundária de Proteína , Homologia de Sequência de Aminoácidos
19.
Arch Biochem Biophys ; 330(2): 229-37, 1996 Jun 15.
Artigo em Inglês | MEDLINE | ID: mdl-8660651

RESUMO

Amino acid compositions (AAC) of proteins were analyzed in terms of their uniqueness and variability. Using several measures of convergence between the AACs of randomly chosen proteins versus those stored in protein data banks, it was established that certain families of proteins have unique AACs despite the mutations of their sequences which were imposed in the process of evolution. AACs may be used to establish the identities of many proteins which were sorted through various chromatographic media prior to their fractionation on two-dimensional (2D) gels. Subfractionations of proteins markedly enhance the chances for proper identification of low-abundant proteins which rest inaccessible if the total protein extract of an organ is analyzed on 2D gels. Although the amino acid composition versus protein identity (AAC-PI) method allows identification with high confidence of unique proteins resolved on monodimensional SDS-PAGE (1D) gels and arrays of protein isoforms resolved on two-dimensional (2D) gels, selective immunoblotting is still a more robust method. Thus, in principle, the AAC-PI method may allow limiting the number of "unknown" spots on 2D gels which could be further investigated by microsequencing and/or mass spectroscopy. However, to resolve certain ambiguities inherently linked with protein identities derived only from their AACs, the AAC-PI method must be sometimes aided by microsequencing and immunoblotting, especially in the construction of high-resolution 2D maps of proteins. A suite of algorithms which form the AAC-PI method are described in detail.


Assuntos
Aminoácidos/análise , Proteínas/química , Algoritmos , Sequência de Aminoácidos , Animais , Bases de Dados Factuais , Eletroforese em Gel Bidimensional , Humanos , Dados de Sequência Molecular , Proteínas/genética , Proteínas/isolamento & purificação
20.
Biochem J ; 201(3): 495-9, 1982 Mar 01.
Artigo em Inglês | MEDLINE | ID: mdl-7092808

RESUMO

Isoelectric focusing in a thin layer of polyacrylamide gel is shown to be a suitable method for the resolution of intermediates trapped during the refolding process of reduced cystine-containing proteins. The method has been applied to the well-characterized snake neurotoxin erabutoxin b. An explanation is offered for the relatively low rate of refolding of this polypeptide.


Assuntos
Venenos Elapídicos/metabolismo , Erabutoxinas/metabolismo , Neurotoxinas/metabolismo , Animais , Densitometria , Eletroforese em Gel de Poliacrilamida , Focalização Isoelétrica , Cinética , Oxirredução , Conformação Proteica , Desnaturação Proteica
SELEÇÃO DE REFERÊNCIAS
DETALHE DA PESQUISA