Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 14 de 14
Filtrar
1.
Trop Anim Health Prod ; 51(8): 2269-2278, 2019 Nov.
Artículo en Inglés | MEDLINE | ID: mdl-31152335

RESUMEN

Natural compounds from medicinal plants provide safe and sustainable alternatives to synthetic anthelmintics. In this study, we assessed in vitro and in vivo anthelmintic activity of Cassia occidentalis (NH-A) and Euphorbia hirta (NH-B) and compared it with levamisole-HCl. The shoots of NH-A and whole plant of NH-B were used to prepare extracts using 70% methanol which were used in the in vitro and in vivo assays. In vitro assays of crude methanolic extracts (CMEs) of NH-A and NH-B on larvae of mixed gastrointestinal nematodes (GINs) of goats revealed mortalities of 95.7% (at 100 mg ml-1) and 98.1% (at 50 mgml-1) 24 h postexposure. In vivo assays of NH-A administered orally at doses of 100, 300, 900, and 2700 mg kg-1 bwt revealed dose- and time-dependent anthelmintic effects in goats experimentally infected with mixed species of GINs. NH-B exhibited similar properties when administered at doses of 50, 100, 200, and 400 mg kg-1 bwt. Both NH-A (900 mg kg-1 bwt) and levamisole (7.5 mg kg-1 bwt) achieved a 100% reduction in fecal egg count per gram (EPG) on day 21 and day 14 respectively posttreatment. NH-B (400 mg kg-1 bwt) achieved 93.1% and 86.1% reduction in fecal EPG 7 and 14 days postexposure respectively compared with 88.2% and 82.3% reduction with levamisole-HCl 7 and 14 days postexposure. Our results show that extracts of both plants can disrupt helminth lifecycles by suppressing the egg-laying capacity in adult worms but also kill their infective larvae. Future studies should aim at establishing synergies or antagonisms between the two plant extracts and further development for control of helminths in goats.


Asunto(s)
Antihelmínticos/uso terapéutico , Euphorbia/química , Enfermedades de las Cabras/tratamiento farmacológico , Infecciones por Nematodos/veterinaria , Extractos Vegetales/uso terapéutico , Senna/química , Animales , Heces/parasitología , Enfermedades de las Cabras/epidemiología , Enfermedades de las Cabras/parasitología , Cabras , Levamisol , Nematodos , Infecciones por Nematodos/tratamiento farmacológico , Infecciones por Nematodos/epidemiología , Infecciones por Nematodos/parasitología , Recuento de Huevos de Parásitos/veterinaria , Extractos Vegetales/administración & dosificación , Uganda/epidemiología
2.
NPJ Vaccines ; 9(1): 174, 2024 Sep 18.
Artículo en Inglés | MEDLINE | ID: mdl-39294184

RESUMEN

Vaccines are the most effective and sustainable intervention to control ticks and tick-borne diseases (TBD). Using a personalized vaccine design based on regional tick genotypes, a Rhipicephalus appendiculatus Subolesin protective antigen was used in a field trial evaluating tick vaccine efficacy, effectiveness, and safety in cattle infested with multiple tick species in different Ugandan agro-ecological zones. Vaccination with SUB was safe with a protective capacity against anemia and infection, and reduced the number of infested cattle, tick fitness (feeding and reproduction) with vaccine effectiveness against multiple tick species between 93.2% at 167-196 days post-vaccination (dpv) and 61.4% at 251-327 dpv. Total integrated vaccine efficacy/effectiveness was estimated as 98.8%. The Subolesin-based vaccine is protective against multiple cattle tick infestations under field conditions in Uganda. These results support registration and commercialization of the vaccine to reduce tick populations and associated risks for human and animal TBD and chemical acaracides in Uganda.

3.
Pathogens ; 12(10)2023 Oct 19.
Artículo en Inglés | MEDLINE | ID: mdl-37887774

RESUMEN

In this comprehensive review study, we addressed the challenge posed by ticks and tick-borne diseases (TBDs) with growing incidence affecting human and animal health worldwide. Data and perspectives were collected from different countries and regions worldwide, including America, Europe, Africa, Asia, and Oceania. The results updated the current situation with ticks and TBD and how it is perceived by society with information bias and gaps. The study reinforces the importance of multidisciplinary and international collaborations to advance in the surveillance, communication and proposed future directions to address these challenges.

4.
Vaccines (Basel) ; 10(8)2022 Aug 16.
Artículo en Inglés | MEDLINE | ID: mdl-36016215

RESUMEN

Vaccination is an environmentally-friendly alternative for tick control. The tick antigen Subolesin (SUB) has shown protection in vaccines for the control of multiple tick species in cattle. Additionally, recent approaches in quantum vaccinomics have predicted SUB-protective epitopes and the peptide sequences involved in protein−protein interactions in this tick antigen. Therefore, the identification of B-cell−reactive epitopes by epitope mapping using a SUB peptide array could be essential as a novel strategy for vaccine development. Subolesin can be used as a model to evaluate the effectiveness of these approaches for the identification of protective epitopes related to vaccine protection and efficacy. In this study, the mapping of B-cell linear epitopes of SUB from three different tick species common in Uganda (Rhipicephalus appendiculatus, R. decoloratus, and Amblyomma variegatum) was conducted using serum samples from two cattle breeds immunized with SUB-based vaccines. The results showed that in cattle immunized with SUB from R. appendiculatus (SUBra) all the reactive peptides (Z-score > 2) recognized by IgG were also significant (Z-ratio > 1.96) when compared to the control group. Additionally, some of the reactive peptides recognized by IgG from the control group were also recognized in SUB cocktail−immunized groups. As a significant result, cattle groups that showed the highest vaccine efficacy were Bos indicus immunized with a SUB cocktail (92%), and crossbred cattle were immunized with SUBra (90%) against R. appendiculatus ticks; the IgG from these groups recognized overlapping epitopes from the peptide SPTGLSPGLSPVRDQPLFTFRQVGLICERMMKERESQIRDEYDHVLSAKLAEQYDTFVKFTYDQKRFEGATPSYLS (Z-ratio > 1.96), which partially corresponded to a Q38 peptide and the SUB protein interaction domain. These identified epitopes could be related to the protection and efficacy of the SUB-based vaccines, and new chimeras containing these protective epitopes could be designed using this new approach.

5.
Vaccines (Basel) ; 11(1)2022 Dec 31.
Artículo en Inglés | MEDLINE | ID: mdl-36679944

RESUMEN

Ticks are worldwide ectoparasites to humans and animals, and are associated with numerous health and economic effects. Threatening over 80% of the global cattle population, tick and tick-borne diseases (TTBDs) particularly constrain livestock production in the East, Central and Southern Africa. This, therefore, makes their control critical to the sustainability of the animal industry in the region. Since ticks are developing resistance against acaricides, anti-tick vaccines (ATVs) have been proposed as an environmentally friendly control alternative. Whereas they have been used in Latin America and Australia to reduce tick populations, pathogenic infections and number of acaricide treatments, commercially registered ATVs have not been adopted in tropical Africa for tick control. This is majorly due to their limited protection against economically important tick species of Africa and lack of research. Recent advances in various omics technologies and reverse vaccinology have enabled the identification of many candidate anti-tick antigens (ATAs), and are likely to usher in the next generation of vaccines, for which Africa should prepare to embrace. Herein, we highlight some scientific principles and approaches that have been used to identify ATAs, outline characteristics of a desirable ATA for vaccine design and propose the need for African governments to investment in ATV research to develop vaccines relevant to local tick species (personalized vaccines). We have also discussed the prospect of incorporating anti-tick vaccines into the integrated TTBDs control strategies in the sub-Saharan Africa, citing the case of Uganda.

6.
Vaccines (Basel) ; 10(10)2022 Sep 22.
Artículo en Inglés | MEDLINE | ID: mdl-36298461

RESUMEN

A collaboration program was established between the group of Health and Biotechnology (SaBio) of the IREC Institute of Game and Wildlife Research (CSIC-UCLM-JCCM, Spain) and the National Agricultural Research Organization of Uganda (NARO) for the development of vaccines for the control of cattle ticks in Uganda. Controlled pen trials identified a tick protective antigen, Rhipicephalus appendiculatus Subolesin, and a cross-species-effective vaccine formulation. As the next step, a controlled vaccine field trial has been approved by Ugandan state regulatory authorities, the Uganda National Council for Science and Technology (UNCST) and the National Drug Authority (NDA), to evaluate the efficacy and effectiveness of the vaccine formulation for the control of cattle tick infestations under field conditions. The results of this trial may lead to the approval of the vaccine for application in Uganda to improve cattle health and production while reducing the use of acaricides.

7.
Vaccine ; 40(32): 4564-4573, 2022 07 30.
Artículo en Inglés | MEDLINE | ID: mdl-35728991

RESUMEN

Tick vaccines are necessary as part of a One Health approach for the control of tick infestations and tick-borne diseases. Subolesin (SUB, also known as 4D8) is a tick protective antigen that has shown efficacy in vaccine formulations for the control of ectoparasite infestations and pathogen infection/transmission. A recent proof-of-concept study reported oral vaccination combining Rhipicephalus microplus SUB with heat inactivated Mycobacterium bovis (IV) as an immunostimulant for the control of cattle tick infestations. Based on the efficacy of Rhipicephalus decoloratus SUB for the control of multiple cattle tick species in Uganda, herein we design a controlled pen trial using an oral formulation combining R. decoloratus SUB with IV for the control of R. decoloratus and Rhipicephalus appendiculatus cattle tick infestations. Vaccine efficacy (E) of SUB + IV on tick life cycle was compared with IV and SUB alone and with PBS as control. The IgG antibody titers against SUB and M. bovis P22 and the serum levels of selected protein immune biomarkers (IL-1beta, TNF-alpha, C3) were determined and analyzed as possible correlates of protection. Oral immunization with IV and SUB alone and in SUB + IV combination were effective for the control of tick infestations (E = 71-96% for R. decoloratus and 87-99% for R. appendiculatus) with highest E (higher than 95%) for SUB + IV. The results demonstrated that oral immunization with the SUB + IV formulation resulted in effective control of cattle tick infestations through the activation of multiple immune mechanisms. These results support the application of oral vaccine formulations with SUB + IV for the control of cattle infestations with Rhipicephalus species towards improving animal health.


Asunto(s)
Enfermedades de los Bovinos , Mycobacterium bovis , Rhipicephalus , Infestaciones por Garrapatas , Vacunas , Animales , Bovinos , Enfermedades de los Bovinos/prevención & control , Calor , Infestaciones por Garrapatas/prevención & control , Infestaciones por Garrapatas/veterinaria
8.
Vaccines (Basel) ; 8(2)2020 Jun 18.
Artículo en Inglés | MEDLINE | ID: mdl-32570925

RESUMEN

Cattle tick infestations and transmitted pathogens affect animal health, production and welfare with an impact on cattle industry in tropical and subtropical countries. Anti-tick vaccines constitute an effective and sustainable alternative to the traditional methods for the control of tick infestations. Subolesin (SUB)-based vaccines have shown efficacy for the control of multiple tick species, but several factors affect the development of new and more effective vaccines for the control of tick infestations. To address this challenge, herein we used a regional and host/tick species driven approach for vaccine design and implementation. The objective of the study was to develop SUB-based vaccines for the control of the most important tick species (Rhipicephalus appendiculatus, R. decoloratus and Amblyomma variegatum) affecting production of common cattle breeds (Bos indicus and B. indicus x B. taurus crossbred) in Uganda. In this way, we addressed the development of anti-tick vaccines as an intervention to prevent the economic losses caused by ticks and tick-borne diseases in the cattle industry in Uganda. The results showed the possibility of using SUB antigens for the control of multiple tick species in B. indicus and crossbred cattle and suggested the use of R. appendiculatus SUB to continue research on vaccine design and formulation for the control of cattle ticks in Uganda. Future directions would include quantum vaccinology approaches based on the characterization of the SUB protective epitopes, modeling of the vaccine E under Ugandan ecological and epidemiological conditions and optimization of vaccine formulation including the possibility of oral administration.

9.
Transbound Emerg Dis ; 67 Suppl 1: 99-107, 2020 Mar.
Artículo en Inglés | MEDLINE | ID: mdl-32174038

RESUMEN

Theileria parva is a tick-transmitted apicomplexan protozoan parasite that infects lymphocytes of cattle and African Cape buffalo (Syncerus caffer), causing a frequently fatal disease of cattle in eastern, central and southern Africa. A live vaccination procedure, known as infection and treatment method (ITM), the most frequently used version of which comprises the Muguga, Serengeti-transformed and Kiambu 5 stocks of T. parva, delivered as a trivalent cocktail, is generally effective. However, it does not always induce 100% protection against heterologous parasite challenge. Knowledge of the genetic diversity of T. parva in target cattle populations is therefore important prior to extensive vaccine deployment. This study investigated the extent of genetic diversity within T. parva field isolates derived from Ankole (Bos taurus) cattle in south-western Uganda using 14 variable number tandem repeat (VNTR) satellite loci and the sequences of two antigen-encoding genes that are targets of CD8+T-cell responses induced by ITM, designated Tp1 and Tp2. The findings revealed a T. parva prevalence of 51% confirming endemicity of the parasite in south-western Uganda. Cattle-derived T. parva VNTR genotypes revealed a high degree of polymorphism. However, all of the T. parva Tp1 and Tp2 alleles identified in this study have been reported previously, indicating that they are widespread geographically in East Africa and highly conserved.


Asunto(s)
Antígenos de Protozoos/genética , Búfalos/parasitología , Enfermedades de los Bovinos/parasitología , Repeticiones de Minisatélite/genética , Vacunas Antiprotozoos/inmunología , Theileria parva/genética , Theileriosis/parasitología , Alelos , Animales , Linfocitos T CD8-positivos/inmunología , Linfocitos T CD8-positivos/parasitología , Bovinos , Enfermedades de los Bovinos/epidemiología , Enfermedades de los Bovinos/prevención & control , Femenino , Variación Genética , Genotipo , Masculino , Polimorfismo Genético/genética , Theileria parva/inmunología , Theileriosis/epidemiología , Theileriosis/prevención & control , Garrapatas/parasitología , Uganda/epidemiología , Vacunas Atenuadas/inmunología
10.
Vaccines (Basel) ; 7(4)2019 Oct 31.
Artículo en Inglés | MEDLINE | ID: mdl-31683596

RESUMEN

A meeting and course supported by the Vice-Presidency for International Affairs of the Spanish National Research Council (CSIC) and the National Agricultural Research Organization of Uganda (NARO) were held at the National Livestock Resources Research Institute (NaLIRRI) in Nakyesasa, Wakiso, Uganda on September 2-9, 2019. The activities were conducted within the collaboration program between the Institute of Game and Wildlife Research (IREC, CSIC-UCLM-JCCM, Spain) and NARO for the development of vaccines and other interventions for the control of cattle ticks in Uganda.

11.
Front Genet ; 9: 385, 2018.
Artículo en Inglés | MEDLINE | ID: mdl-30333851

RESUMEN

East Coast fever (ECF) is a fatal sickness affecting cattle populations of eastern, central, and southern Africa. The disease is transmitted by the tick Rhipicephalus appendiculatus, and caused by the protozoan Theileria parva parva, which invades host lymphocytes and promotes their clonal expansion. Importantly, indigenous cattle show tolerance to infection in ECF-endemically stable areas. Here, the putative genetic bases underlying ECF-tolerance were investigated using molecular data and epidemiological information from 823 indigenous cattle from Uganda. Vector distribution and host infection risk were estimated over the study area and subsequently tested as triggers of local adaptation by means of landscape genomics analysis. We identified 41 and seven candidate adaptive loci for tick resistance and infection tolerance, respectively. Among the genes associated with the candidate adaptive loci are PRKG1 and SLA2. PRKG1 was already described as associated with tick resistance in indigenous South African cattle, due to its role into inflammatory response. SLA2 is part of the regulatory pathways involved into lymphocytes' proliferation. Additionally, local ancestry analysis suggested the zebuine origin of the genomic region candidate for tick resistance.

12.
Ticks Tick Borne Dis ; 7(2): 291-7, 2016 Mar.
Artículo en Inglés | MEDLINE | ID: mdl-26613662

RESUMEN

Theileria parva causes East Coast Fever (ECF) a protozoan infection which manifests as a non-symptomatic syndrome among endemically stable indigenous cattle populations. Knowledge of the current genetic diversity and population structure of T. parva is critical for predicting pathogen evolutionary trends to inform development of effective control strategies. In this study the population genetic structure of 78 field isolates of T. parva from indigenous cattle (Ankole, n=41 and East African shorthorn Zebu (EASZ), n=37) sampled from the different agro ecological zones (AEZs) of Uganda was investigated. A total of eight mini- and micro-satellite markers encompassing the four chromosomes of T. parva were used to genotype the study field isolates. The genetic diversity of the surveyed T. parva populations was observed to range from 0.643±0.55 to 0.663±0.41 among the Central and Western AEZs respectively. The overall Wright's F index showed significant genetic variation between the surveyed T. parva populations based on the different AEZs and indigenous cattle breeds (FST=0.133, p<0.01) and (FST=0.101, p<0.01) respectively. Significant pairwise population genetic differentiations (p<0.05) were observed with FST values ranging from 0.048 to 0.173 between the eastern and northern, eastern and western populations respectively. The principal component analysis (PCA) showed a high level of genetic and geographic sub-structuring among populations. Linkage disequilibrium was observed when populations from all the study AEZs were treated as a single population and when analysed separately. On the overall, the significant genetic diversity and geographic sub-structuring exhibited among the study T. parva isolates has critical implications for ECF control.


Asunto(s)
Enfermedades de los Bovinos/parasitología , Variación Genética , Genética de Población , Theileria parva/genética , Theileriosis/parasitología , Animales , Bovinos , Enfermedades de los Bovinos/epidemiología , Genotipo , Repeticiones de Microsatélite/genética , Theileria parva/aislamiento & purificación , Theileriosis/epidemiología , Uganda/epidemiología
13.
Prev Vet Med ; 121(1-2): 56-63, 2015 Sep 01.
Artículo en Inglés | MEDLINE | ID: mdl-26100405

RESUMEN

Indigenous cattle populations exhibit various degrees of agro-ecological fitness and provide desirable opportunities for investments to improve sustainable production for better rural small-scale farmers' incomes globally. However, they could be a source of infection to their attendants and other susceptible livestock if their brucellosis status remains unknown. This study investigated the spatial distribution of Brucella antibodies among indigenous cattle populations in Uganda. Sera from a total of 925 indigenous cattle (410 Ankole Bos taurus indicus, 50 Nganda and 465 East African Shorthorn Zebu (EASZ) - B. indicus) obtained randomly from 209 herds spread throughout Uganda were sequentially analysed for Brucella antibodies using the indirect (I) and competitive (C) enzyme linked Immuno-sorbent assays (ELISA). Recent incidences of abortion within the previous 12 months and routine hygienic practices during parturition were explored for public health risks. Brucella antibodies occurred in approximately 8.64% (80/925) and 28.70% (95% CI: 22.52, 34.89) of the sampled individual cattle and herds, respectively. Findings have shown that Ankole and EASZ cattle had similar seroprevalences. Indigenous cattle from the different study agro-ecological zones (AEZs) exhibited varying seroprevalences ranging from approximately 1.78% (95% CI: 0, 5.29) to 19.67% (95% CI: 8.99, 30.35) in the Lake Victoria Crescent (LVC) and North Eastern Drylands (NED) respectively. Significantly higher odds for Brucella antibodies occurred in the NED (OR: 3.40, 95% CI: 1.34, 8.57, p=0.01) inhabited by EASZ cattle compared to the KP (reference category) AEZ. Recent incidences of abortions within the previous 12 months were significantly (p<0.001) associated with seropositive herds. These findings add critical evidence to existing information on the widespread occurrence of brucellosis among indigenous cattle populations in Uganda and could guide allocation of meagre resources for awareness creation. And deployment of control strategies including culling of older cattle and those which have aborted during advanced gestation, enforcement of hygiene practices and mass vaccination.


Asunto(s)
Brucella/aislamiento & purificación , Brucelosis Bovina/epidemiología , Ecosistema , Aborto Veterinario/epidemiología , Aborto Veterinario/microbiología , Crianza de Animales Domésticos , Animales , Anticuerpos Antibacterianos/sangre , Brucelosis Bovina/microbiología , Bovinos , Ensayo de Inmunoadsorción Enzimática/veterinaria , Femenino , Incidencia , Masculino , Prevalencia , Factores de Riesgo , Estudios Seroepidemiológicos , Uganda/epidemiología
14.
Parasit Vectors ; 7: 414, 2014 Sep 01.
Artículo en Inglés | MEDLINE | ID: mdl-25175844

RESUMEN

BACKGROUND: Non-clinical Theileria parva infection among indigenous cattle occurs upon recovery from primary disease during the first year of life. Continuous exposure to infection through contaminated tick infestations with absence of clinical disease gives rise to endemic stability. Endemic stable populations may become sources of infection if contaminated tick vectors are shared with susceptible exotic cattle. This study aimed at establishing a nationwide distribution of non-clinical T. parva infection among indigenous cattle populations to inform novel control strategies. METHODS: The occurrence of non-clinical T. parva infection among apparently healthy 925 indigenous cattle from 209 herds spread out in 10 agro-ecological zones (AEZs) was determined using a nested PCR assay. The influence of AEZ, breed, sex, age and farmers' ranking of ECF importance were interrogated for influence of non-clinical parasite occurrence. RESULTS: The overall prevalence of non-clinical T. parva infection was 30% (278/925). A gradual increase of non-clinical T. parva infection was observed ranging from 17% (95% CI: 0.03-0.23) to 43% (95% CI: 0.3-0.55) in the North Eastern Savannah Grasslands (NESG) to the Western Highland Ranges (WHR) respectively. A similarly associated 18% (95% CI: 0.07-0.28) and 35% (95% CI: 0.3-0.39) non-clinical parasite prevalence was observed among the East African shorthorn Zebu (EASZ) and Ankole cattle respectively. Average herd level non-clinical T. parva prevalence was 28%, ranging from zero to 100%. The likelihood of non-clinical T. parva infection was 35.5% greater in the western highlands compared to the northeastern semi-arid AEZs. CONCLUSIONS: Non-clinical T. parva occurs countrywide, structured along patterns of AEZ and breed gradients. These findings may guide policy formulation, deployment of integrated control strategies and local cattle improvement programs.


Asunto(s)
Agricultura , Ecosistema , Theileria parva , Theileriosis/parasitología , Animales , Bovinos , Femenino , Masculino , Prevalencia , Theileriosis/epidemiología , Uganda/epidemiología
SELECCIÓN DE REFERENCIAS
DETALLE DE LA BÚSQUEDA