ABSTRACT
Hierarchical biobased micro/nanomaterials offer great potential as the next-generation building blocks for robust films or macroscopic fibers with high strength, while their capability in suppressing crack propagation when subject to damage is hindered by their limited length. Herein, we employed an approach to directly convert bulk wood into fibers with a high aspect ratio and nanosized branching structures. Particularly, the length of microfibers surpassed 1 mm with that of the nanosized branches reaching up to 300 µm. The presence of both interwoven micro- and nanofibers endowed the product with substantially improved tensile strength (393.99 MPa) and toughness (19.07 MJ m-3). The unique mechanical properties arose from mutual filling and the hierarchical deformation facilitated by branched nanofibers, which collectively contributed to effective energy dissipation. Hence, the nanotransformation strategy opens the door toward a facial, scalable method for building high-strength film or macroscopic fibers available in various advanced applications.
ABSTRACT
BACKGROUND: Obesity is a common public health issue and is currently deemed a disease. Research has shown that the risk of gallstones in individuals with obesity is elevated. This study aimed to explore the bile proteomics differences between cholelithiasis patients with obesity and normal body weight. METHODS: Bile samples from 20 patients (10 with obesity and 10 with normal body weight) who underwent laparoscopic cholecystectomy at our center were subjected to tandem mass tag labeling (TMT) and liquid chromatography-tandem mass spectrometry (LC-MS/MS), followed by further bioinformatic analysis. RESULTS: Among the differentially-expressed proteins, 23 were upregulated and 67 were downregulated. Bioinformatic analysis indicated that these differentially-expressed proteins were mainly involved in cell development, inflammatory responses, glycerolipid metabolic processes, and protein activation cascades. In addition, the activity of the peroxisome proliferator-activated receptor (PPAR, a subfamily of nuclear receptors) signaling pathway was decreased in the Kyoto Encyclopedia of Genes and Genomes (KEGG) enrichment analysis. Two downregulated proteins in the PPAR signaling pathway, APOA-I and APOA-II, were confirmed using enzyme-linked immunosorbent assay. CONCLUSIONS: The PPAR signaling pathway may play a crucial role in the development of cholelithiasis among patients with obesity. Furthermore, biliary proteomics profiling of gallstones patients with obesity is revealed, providing a reference for future research.
ABSTRACT
Human voltage-gated sodium channel Nav1.7 (hNav1.7) is involved in the generation and conduction of neuropathic and nociceptive pain signals. Compelling genetic and preclinical studies have validated that hNav1.7 is a therapeutic target for the treatment of pain; however, there is a dearth of currently available compounds capable of targeting hNav1.7 with high potency and specificity. Hainantoxin-III (HNTX-III) is a 33-residue polypeptide from the venom of the spider Ornithoctonus hainana. It is a selective antagonist of neuronal tetrodotoxin-sensitive voltage-gated sodium channels. Here, we report the engineering of improved potency and Nav selectivity of hNav1.7 inhibition peptides derived from the HNTX-III scaffold. Alanine scanning mutagenesis showed key residues for HNTX-III interacting with hNav1.7. Site-directed mutagenesis analysis indicated key residues on hNav1.7 interacting with HNTX-III. Molecular docking was conducted to clarify the binding interface between HNTX-III and Nav1.7 and guide the molecular engineering process. Ultimately, we obtained H4 [K0G1-P18K-A21L-V] based on molecular docking of HNTX-III and hNav1.7 with a 30-fold improved potency (IC50 0.007 ± 0.001 µM) and >1000-fold selectivity against Nav1.4 and Nav1.5. H4 also showed robust analgesia in the acute and chronic inflammatory pain model and neuropathic pain model. Thus, our results provide further insight into peptide toxins that may prove useful in guiding the development of inhibitors with improved potency and selectivity for Nav subtypes with robust analgesia.
Subject(s)
NAV1.7 Voltage-Gated Sodium Channel/genetics , Nociceptive Pain/drug therapy , Peptides/genetics , Spider Venoms/chemistry , Animals , Humans , Molecular Docking Simulation , NAV1.4 Voltage-Gated Sodium Channel/drug effects , NAV1.4 Voltage-Gated Sodium Channel/genetics , NAV1.5 Voltage-Gated Sodium Channel/drug effects , NAV1.5 Voltage-Gated Sodium Channel/genetics , NAV1.7 Voltage-Gated Sodium Channel/chemistry , NAV1.7 Voltage-Gated Sodium Channel/drug effects , Nociceptive Pain/genetics , Nociceptive Pain/pathology , Peptides/chemistry , Peptides/pharmacology , Spider Venoms/geneticsABSTRACT
BACKGROUND: The aim of the study was to investigate the predictive value of neutrophil to lymphocyte ratio (NLR) and platelet to lymphocyte ratio (PLR) in missed miscarriage. METHODS: In this retrospective cohort study, a total of 400 women (involving 200 with missed early miscarriage and 200 with normal pregnancy but terminate by artificial abortion) were included. General clinical data and complete blood count (CBC) such as white blood cells (WBC), red blood cells (RBC), platelet (PLT), red blood cell distribution width-standard deviation (RDW-SD), platelet distribution width (PDW), mean platelet volume (MPV), neutrophil count, and lymphocyte count were collected, and the NLR and PLR were calculated for both groups. Receiver operating characteristic curve (ROC) was used to calculate the predictive value. RESULTS: There was no significant difference in the WBC, RBC, PLT, RDW-SD, PDW, neutrophil, lymphocyte, NLR, and PLR between the two groups (p > 0.05).But MPV was lower in the missed early miscarriage group than in the control group (p < 0.05), and the area under the working curve (AUC) of ROC was 0.58, specificity and sensitivity was 69% and 47%, respectively. CONCLUSION: NLR and PLR were not the suitable indictor for missed miscarriage, but MPV should be a concern in the first trimester.
Subject(s)
Abortion, Spontaneous , Neutrophils , Abortion, Spontaneous/diagnosis , Biomarkers , Female , Humans , Leukocyte Count , Lymphocytes , Pregnancy , ROC Curve , Retrospective StudiesABSTRACT
Estimating the boll development and boll yield from single-leaf photosynthesis is difficult as the source-sink relationship of cotton (Gossypium hirsutum L.) is complicated. As the boll-leaf system (BLS), which includes the main-stem leaf, sympodial leaf, and non-leaf organs, is the basic unit of the cotton source-sink relationship and yield formation, the concept of "BLS photosynthesis" is introduced in this study. We speculate that the characteristics of BLS gas exchange can more accurately reflect the photosynthetic function of the system, thus revealing the law of photosynthesis in the process of boll development. The results showed that the photosynthetic rate of single leaves measured by a BLS chamber was consistent with that measured by a standard single-leaf chamber. BLSs exhibited typical light response curves, and the shape of the curves was similar to those of single leaves. The light compensation point and respiration rate of BLSs were higher than those of single leaves, while the apparent quantum efficiency of BLSs was lower. Compared with single leaves, the duration of the photosynthetic function of BLSs was longer. Increasing plant density decreased the gas exchange rate per unit BLS more significantly under field conditions. There was a better linear correlation between the net CO2 assimilation rate, respiration rate of BLSs and boll biomass. Therefore, we think that the gas exchange of BLSs can better reveal the changes in photosynthetic function of BLSs and boll development. This provides a new basis for analyzing the mechanism and regulation of cotton yield formation.
Subject(s)
Gossypium , Photosynthesis , Biomass , Plant LeavesABSTRACT
Cotton has many leaves and even more bolls, which results in a complicated source-sink relationship. Under water stress, the single boll weight (SBW) of cotton remains relatively stable, while both the leaf area and leaf photosynthetic rate decrease greatly. It is therefore difficult to understand how the formation of SBW is regulated under water stress solely by considering single-leaf photosynthesis. Considering the cotton boll-leaf system (BLS: including the main-stem leaf, sympodial leaves, and non-leaf organs) as the basic unit of the cotton canopy, we speculated that the formation of SBW may depend on photosynthesis in the corresponding BLS under water stress. To verify this hypothesis, five water treatments were set up in the field. The results showed that with increasing water stress, the relative water content (RWC) of the main-stem and sympodial leaves decreased gradually, and the decrease in the sympodial leaves was more obvious. The SBW and the number of BLSs decreased slightly with increasing water stress, while the number of bolls per plant decreased significantly. The area of the BLS decreased gradually with increasing water stress, and the area of sympodial leaves decreased more than that of the main-stem leaves. Gas exchange showed that the photosynthetic rate of the BLS (Pn(BLS)) decreased gradually with increasing water stress. In addition, the single-leaf photosynthesis and carboxylation efficiency (CE) decreased progressively and rapidly with the increase of water stress. Compared with the main-stem leaf, the photosynthetic function of the sympodial leaf decreased more. Further analysis showed that compared with leaf photosynthetic rate, there was a better correlation between Pn(BLS) and SBW. Thus, the formation of SBW mainly depends on Pn(BLS) under water stress, and the increase of BLS to boll is also helpful to maintain SBW to some extent. In BLS, the photosynthesis of the main-stem leaf plays a very important role in maintaining the stability of SBW, while the photosynthetic performance in sympodial leaves may be regulated plastically to influence SBW.
Subject(s)
Dehydration , Gossypium , Photosynthesis , Plant LeavesABSTRACT
Voltage-gated sodium channels are critical for the generation and propagation of action potentials. Gating modifier toxins from spider venom can modulate the gating mechanism of sodium channels and thus have potential as drug leads. Here, we established expression of the gating modifier toxin PaurTx-3, a sodium channel inhibitor found in the venom of the spider Phrixotrichus auratus. Whole-cell voltage-clamp recordings indicated that recombinant PaurTx-3 (rPaurTx-3) inhibited Nav1.4, Nav1.5, and Nav1.7 currents with IC50 values of 61 nM, 72 nM, and 25 nM, respectively. Furthermore, rPaurTx-3 irreversibly inhibited Nav1.7 currents, but had 60-70% recovery in Nav1.4 and Nav1.5 after washing with a bath solution. rPaurTx-3 also hyperpolarized the voltage-dependent steady-state inactivation curve and significantly slowed recovery from fast inactivation of Nav1.7. Current-clamp recordings showed that rPaurTx-3 suppressed small DRG neuron activity. The biological activity assay findings for rPaurTx-3 support its potent pharmacological effect in Nav1.7 and small DRG neurons.
Subject(s)
Arthropod Proteins/toxicity , Ganglia, Spinal/drug effects , Ganglia, Spinal/metabolism , Spider Venoms/toxicity , Voltage-Gated Sodium Channel Blockers/toxicity , Action Potentials/drug effects , Amino Acid Sequence , Animals , Arthropod Proteins/genetics , Ganglia, Spinal/cytology , HEK293 Cells , Humans , Ion Channel Gating/drug effects , Mice , Mice, Inbred ICR , Muscle Proteins/antagonists & inhibitors , Muscle Proteins/genetics , Muscle Proteins/metabolism , NAV1.5 Voltage-Gated Sodium Channel/drug effects , NAV1.5 Voltage-Gated Sodium Channel/genetics , NAV1.5 Voltage-Gated Sodium Channel/metabolism , NAV1.7 Voltage-Gated Sodium Channel/drug effects , NAV1.7 Voltage-Gated Sodium Channel/genetics , NAV1.7 Voltage-Gated Sodium Channel/metabolism , Patch-Clamp Techniques , Rats , Recombinant Proteins/genetics , Recombinant Proteins/toxicity , Sensory Receptor Cells/drug effects , Sensory Receptor Cells/metabolism , Sequence Alignment , Sodium Channels/genetics , Sodium Channels/metabolism , Spider Venoms/genetics , Voltage-Gated Sodium Channels/drug effects , Voltage-Gated Sodium Channels/genetics , Voltage-Gated Sodium Channels/metabolismABSTRACT
Monitoring of wound pH is critical for interpreting wound status, because early identification of wound infection or nonhealing wounds is conducive to administion of therapies at the right time. Here, novel orange-emissive carbon quantum dots (O-CDs) are synthesized via microwave-assisted heating of 1,2,4-triaminobenzene and urea aqueous solution. The as-prepared O-CDs exhibit distinctive colorimetric response to pH changing, and also display pH-sensitive fluorescence. Benefiting from the response of O-CDs over a wound-relevant pH range (5-9), medical cotton cloth is selected to immobilize O-CDs through hydrogen bond interactions, the resultant O-CDs-coated cloth with emission at 560 nm shows a high response to pH variation in the range of 5-9 via both fluorescence and visible colorimetric changes. Moreover, the sensitivity of fluorescence to pH is capable of establishing an analytical mode for determining pH value. Further, the O-CDs-based pH indicator possesses not only superior biocompatibility and drug compatibility but also excellent resistance leachability and high reversibility. Importantly, the usage of O-CDs-coated cloth to detect pH is free from the interference of blood contamination and long-term storage, thus providing a valuable strategy for wound pH monitoring through visual response and quantitative determination.
Subject(s)
Carbon/chemistry , Colorimetry , Light , Quantum Dots/chemistry , Wound Healing , Animals , Cell Death , Cell Line , Hydrogen-Ion Concentration , Mice , Quantum Dots/ultrastructure , Rats , Solutions , Spectrometry, FluorescenceABSTRACT
Human genetic and pharmacological studies have demonstrated that voltage-gated sodium channels (VGSCs) are promising therapeutic targets for the treatment of pain. Spider venom contains many toxins that modulate the activity of VGSCs. To date, only 0.01% of such spider toxins has been explored, and thus there is a great potential for discovery of novel VGSC modulators as useful pharmacological tools or potential therapeutics. In the current study, we identified a novel peptide, µ-TRTX-Ca1a (Ca1a), in the venom of the tarantula Cyriopagopus albostriatus. This peptide consisted of 38 residues, including 6 cysteines, i.e. IFECSISCEIEKEGNGKKCKPKKCKGGWKCKFNICVKV. In HEK293T or ND7/23 cells expressing mammalian VGSCs, this peptide exhibited the strongest inhibitory activity on Nav1.7 (IC50 378 nM), followed by Nav1.6 (IC50 547 nM), Nav1.2 (IC50 728 nM), Nav1.3 (IC50 2.2 µM) and Nav1.4 (IC50 3.2 µM), and produced negligible inhibitory effect on Nav1.5, Nav1.8, and Nav1.9, even at high concentrations of up to 10 µM. Furthermore, this peptide did not significantly affect the activation and inactivation of Nav1.7. Using site-directed mutagenesis of Nav1.7 and Nav1.4, we revealed that its binding site was localized to the DIIS3-S4 linker region involving the D816 and E818 residues. In three different mouse models of pain, pretreatment with Cala (100, 200, 500 µg/kg) dose-dependently suppressed the nociceptive responses induced by formalin, acetic acid or heat. These results suggest that Ca1a is a novel neurotoxin against VGSCs and has a potential to be developed as a novel analgesic.
Subject(s)
Analgesics/pharmacology , Arthropod Proteins/pharmacology , Neurotoxins/pharmacology , Spider Venoms/pharmacology , Spiders/chemistry , Amino Acid Sequence , Analgesics/isolation & purification , Analgesics/metabolism , Animals , Arthropod Proteins/isolation & purification , Arthropod Proteins/metabolism , Cell Line, Tumor , Ganglia, Spinal/drug effects , HEK293 Cells , Humans , Mice, Inbred C57BL , NAV1.7 Voltage-Gated Sodium Channel/genetics , NAV1.7 Voltage-Gated Sodium Channel/metabolism , Neurons/drug effects , Neurotoxins/isolation & purification , Neurotoxins/metabolism , Periplaneta , Protein Binding , Spider Venoms/isolation & purification , Spider Venoms/metabolism , Voltage-Gated Sodium Channel Blockers/isolation & purification , Voltage-Gated Sodium Channel Blockers/metabolism , Voltage-Gated Sodium Channel Blockers/pharmacologyABSTRACT
Scolopendra subspinipes mutilans, also known as Chinese red-headed centipede, is a venomous centipede from East Asia and Australasia. Venom from this animal has not been researched as thoroughly as venom from snakes, snails, scorpions, and spiders. In this study, we isolated and characterized SsmTx-I, a novel neurotoxin from the venom of S. subspinipes mutilans. SsmTx-I contains 36 residues with four cysteines forming two disulfide bonds. It had low sequence similarity (<10%) with other identified peptide toxins. By whole-cell recording, SsmTx-I significantly blocked voltage-gated K⺠channels in dorsal root ganglion neurons with an IC50 value of 200 nM, but it had no effect on voltage-gated Na⺠channels. Among the nine K⺠channel subtypes expressed in human embryonic kidney 293 cells, SsmTx-I selectively blocked the Kv2.1 current with an IC50 value of 41.7 nM, but it had little effect on currents mediated by other K⺠channel subtypes. Blockage of Kv2.1 by SsmTx-I was not associated with significant alteration of steady-state activation, suggesting that SsmTx-I might act as a simple inhibitor or channel blocker rather than a gating modifier. Our study reported a specific Kv2.1-blocker from centipede venom and provided a basis for future investigations of SsmTx-I, for example on structure-function relationships, mechanism of action, and pharmacological potential.
Subject(s)
Drugs, Chinese Herbal/chemistry , Potassium Channels, Voltage-Gated/drug effects , Shab Potassium Channels/drug effects , Venoms/pharmacology , Animals , Cell Line , Diterpene Alkaloids , Humans , Patch-Clamp Techniques , RatsABSTRACT
Halide perovskites exhibit exceptional optoelectronic properties for photoelectrochemical production of solar fuels and chemicals but their instability in aqueous electrolytes hampers their application. Here we present ultrastable perovskite CsPbBr3-based photoanodes achieved with both multifunctional glassy carbon and boron-doped diamond sheets coated with Ni nanopyramids and NiFeOOH. These perovskite photoanodes achieve record operational stability in aqueous electrolytes, preserving 95% of their initial photocurrent density for 168 h of continuous operation with the glassy carbon sheets and 97% for 210 h with the boron-doped diamond sheets, due to the excellent mechanical and chemical stability of glassy carbon, boron-doped diamond, and nickel metal. Moreover, these photoanodes reach a low water-oxidation onset potential close to +0.4 VRHE and photocurrent densities close to 8 mA cm-2 at 1.23 VRHE, owing to the high conductivity of glassy carbon and boron-doped diamond and the catalytic activity of NiFeOOH. The applied catalytic, protective sheets employ only earth-abundant elements and straightforward fabrication methods, engineering a solution for the success of halide perovskites in stable photoelectrochemical cells.
ABSTRACT
OBJECTIVE: Airline pilots are members of a unique occupational group that is often confronted with sleep routine disruptions, yet relatively few studies have examined their mental health status. This study assessed the prevalence and network structure of internet addiction, depression and sleep quality problems in commercial airline pilots. METHOD: A total of 7055 airline pilots were included in analyses. Internet addiction and depression were measured with the Internet Addiction Test (IAT) and 9-item Patient Health Questionnaire (PHQ-9), respectively. Sleep quality was evaluated using the Pittsburgh Sleep Quality Index (PSQI). The network model was constructed based on an Ising model and its association with sleep quality was evaluated using a flow procedure. RESULTS: Internet addiction, depression and sleep quality were common among airline pilots. The prevalence of internet addiction was 8.0 % (95 % CI: 7.3-8.6 %), while the rates of depression and poor sleep quality were 23.3 % (95 % CI: 22.3-24.2 %) and 33.0 % (95 % CI: 31.9-34.1 %), respectively. In the depression and internet addiction network model, "Fatigue" (PHQ4; Expected Influence (EI): 2.04) and "Depressed/moody/nervous only while being offline" (IAT20; EI: 1.76) were most central symptoms while "Fatigue" (PHQ4; Bridge EI: 1.30) was also the most important bridge symptom. The flow network model of sleep quality with internet addiction and depression showed that "Appetite" (PHQ5) had the strongest positive association with poor sleep quality. CONCLUSION: Internet addiction, depression and sleep quality were common among airline pilots and warrant regular screening and timely treatment. Strategies to improve sleep hygiene may be useful in preventing onsets or exacerbations in depression and internet addiction among airline pilots.
Subject(s)
Depression , Internet Addiction Disorder , Sleep Quality , Humans , China/epidemiology , Male , Prevalence , Adult , Internet Addiction Disorder/epidemiology , Depression/epidemiology , Female , Pilots/statistics & numerical data , Middle Aged , Surveys and Questionnaires , Sleep Wake Disorders/epidemiology , Young Adult , InternetABSTRACT
The temperature-concentration behavior of physical gel by atactic poly(methyl methacrylate) (aPMMA) in poly(ethylene glycol) oligomer (PEG400) was investigated. A liquid-liquid demixing interferes with a glass transition during cooling. The combination of demixing and T g leads to the formation of amorphous gels at low temperature. We suggest that the gelation of aPMMA/PEG400 is a glassy gel, in which short-range attractive depletion interaction in the polymer/oligomer system was the driving force at molecular level.
Subject(s)
Polyethylene Glycols/chemistry , Polymethyl Methacrylate/chemistry , Temperature , Gels , Rheology , Solutions , ThermodynamicsABSTRACT
Bioelectronics based on high-performance conductive ionic hydrogels, which can create novel technological interfaces with the human body, have attracted significant interest from both academia and industry. However, it is still a challenge to fabricate hydrogel sensor with integration of good mechanical properties, fast self-healing ability and flexible strain sensitivity below 0 °C. In this paper, we present a moldable, self-healing and adhesive cellulose-based ionic conductive hydrogel with strain-sensitivity, which was prepared by forming dual-crosslinked networks using poly(vinyl alcohol) (PVA) with borax, calcium chloride (CaCl2), zinc chloride (ZnCl2) and 2,2,6,6-tetramethylpiperidine-1-oxyl oxidized cellulose nanofibril (TCNF). The hydrogel exhibited fast self-healing within 10 s, moderate modulus of 5.13 kPa, high elongation rate of 1500 % and excellent adhesion behavior on various substrates. Due to multiple hydrogen bonding and the presence of CaCl2 and ZnCl2, the hydrogel presented a reduced freezing point as low as -41.1 °C, which enabled its application as a low-temperature strain sensor. The proposed hydrogel provides a simple and facile method for fabricating multi-functional hydrogels that can be used as suitable strain sensors for applications such as wearable electronic sensor, soft robotics and electronic skins in a wide temperature range.
Subject(s)
Cellulose, Oxidized , Prunella , Humans , Cellulose , Calcium Chloride , Temperature , Electric Conductivity , Hydrogels , IonsABSTRACT
Gastric undifferentiated/rhabdoid carcinoma is a rare highly invasive tumor of epithelial origin. Due to mutations in the switch/sucrose non-fermentable (SWI/SNF) complex, these tumor cells are usually dedifferentiated, presenting a characteristic rhabdoid profile. In this report, we present a gastric rhabdoid carcinoma in a 77-year-old man who presented with intermittent epigastric pain. Gastroscopy revealed a giant ulcer in the antrum, which proved to be a malignant tumor in the biopsy. Therefore, he was admitted to our hospital and underwent laparoscopic radical gastrectomy and D2 lymphadenectomy. The resected neoplasm contained a variety of rhabdoid cells that lacked well-differentiated elements. Immunohistochemical staining revealed that SMARCA4/BRG1 expression was absent in tumor cells. Finally, the patient was diagnosed with undifferentiated/rhabdoid carcinoma of the stomach. The patient was treated with tegafur-gimeracil-oteracil potassium capsules postoperatively. There were no signs of imaging changes observed at the 18-month follow-up. We reviewed similar cases in previous reports. These tumors are more likely to affect older male adults and usually lack typical symptoms. Histologically, most tumor cells are poorly cohesive and rhabdoid, and differentiated compositions of various degrees can occasionally be seen. Positive staining for vimentin was seen in all tumor cells. Epithelial markers are positive in the majority of tumors. SWI/SNF mutant tumors tend to be associated with a poor prognosis. In this review, more than half of the patients died within one year after surgery. The treatments for these diseases are still being explored.
Subject(s)
Carcinoma , Rhabdoid Tumor , Stomach Neoplasms , Adult , Humans , Male , Aged , Carcinoma/pathology , Stomach Neoplasms/diagnosis , Stomach Neoplasms/genetics , Cell Differentiation , Rhabdoid Tumor/diagnosis , Rhabdoid Tumor/genetics , Biomarkers, Tumor/metabolism , DNA Helicases , Nuclear Proteins , Transcription Factors/geneticsABSTRACT
Polypeptide toxins are major bioactive components found in venomous animals. Many polypeptide toxins can specifically act on targets, such as ion channels and voltage-gated sodium (Nav) channels, in the nervous, muscle, and cardiovascular systems of the recipient to increase defense and predation efficiency. In this study, a novel polypeptide toxin, LmNaTx15, was isolated from the venom of the scorpion Lychas mucronatus, and its activity was analyzed. LmNaTx15 slowed the fast inactivation of Nav1.2, Nav1.3, Nav1.4, Nav1.5, and Nav1.7 and inhibited the peak current of Nav1.5, but it did not affect Nav1.8. In addition, LmNaTx15 altered the voltage-dependent activation and inactivation of these Nav channel subtypes. Furthermore, like site 3 neurotoxins, LmNaTx15 induced pain in mice. These results show a novel scorpion toxin with a modulatory effect on specific Nav channel subtypes and pain induction in mice. Therefore, LmNaTx15 may be a key bioactive component for scorpion defense and predation. Besides, this study provides a basis for analyzing structure-function relationships of the scorpion toxins affecting Nav channel activity.
Subject(s)
Scorpion Venoms , Mice , Animals , Scorpion Venoms/toxicity , Pain/chemically induced , Pain/drug therapy , Neurotoxins , PeptidesABSTRACT
Stiffness switchable materials (e.g., supramolecular polymers, metals) that alter their shape and mechanical properties in response to specific stimuli are potentially utilized in the structural engineering field but still limited due to the use of petroleum-based synthetic monomers and large energy consumption. Herein, a sustainable and facile solvent casting strategy is proposed to fabricate the "hydroplastic wood" with shape and stiffness switchable properties via cell wall wetting, cell wall softening and subsequent moisture evaporation. Therein, a wetting agent with low surface tension and low viscosity is utilized for covering the rough surface of solid wood to form a liquid lubricating layer, thereby increasing the interfacial wettability and achieving uniform softening of the cell walls. This interface wetting treatment can easily break through the hydro-plasticization process for thick wood (Balsa wood, Ochroma lagopus Swartz, density: 0.25 g/cm3; Pinewood, Pinus armandii, density: 0.38 g/cm3). Additionally, the capillary force arising from moisture evaporation induces the self-densification of oriented cellulose nanofibrils and achieves moisture-mediated shape design capabilities through periodic saturation-dehydration. This work makes hydroplastic wood a promising candidate for engineering materials because of its combined advantages of strong durability, formability, and load-carrying capacity.
ABSTRACT
Spider venom is a large pharmacological repertoire of different bioactive peptide toxins. However, obtaining crude venom from some spiders is challenging. Thus, studying individual toxins through venom purification is a daunting task. In this study, we constructed the cDNA library and transcriptomic sequencing from the Macrothele palpator venom glands. Subsequently, 718 high-quality expressed sequence tags (ESTs) were identified, and grouped into three categories, including 449 toxin-like (62.53 %), 136 cellular component (18.94 %) and 133 non-matched (18.52 %) based on the gene function annotation. Additionally, 112 non-redundant toxin-like peptides were classified into 13 families (families A-M) based on their sequence homology and cysteine framework. Bioinformatics analysis revealed a high sequence similarity between families A-J and the toxins from Macrothele gigas in the NR database. In contrast, families K-M had a generally low sequence homology with known spider peptide toxins and unpredictable biological functions. Taken together, this study adds many new members to the spider toxin superfamily and provides a basis for identifying various potential biological tools in M. palpator venom.
Subject(s)
Spider Venoms , Spiders , Humans , Animals , Peptides/genetics , Gene Expression Profiling , Gene Library , Spider Venoms/genetics , Expressed Sequence Tags , Spiders/geneticsABSTRACT
The photocatalytic degradation of organic pollutant by carbon-based materials is still a challenge. Herein, xylose-derived carbon dots (X-CDs) and chitosan-derived CDs (C-CDs) were synthesized by heteroatoms-doping strategy. Although there is almost no difference in fluorescence emission behaviors, the two types of CDs demonstrated different advantages in photocatalysis and peroxymonosulfate (PMS) activation. Comparative research revealed that the X-CDs with doping of heteroatom S was superior in the separation of electron-hole pairs, resulting in a higher catalytic performance, while the S, N co-doped C-CDs can only exhibit high photocatalytic reactivity when they were coupled with PMS. The underlying reason is that the N-related functional groups with strong electron-donating property weakened the electron-trapping capacity of S-related energy level, but surface state resulting from this doping structures were conducive to promoting photo-generated electron transfer from C-CDs to PMS and played the primary role in organic oxidation. Thanks to the doping effect, both the X-CDs and C-CDs/PMS system displayed high photocatalytic performance for methylene blue removal under sunlight irradiation, showing almost 100% degradation efficiency in a 30 min period. The present study provides a valuable insight for the synthesis of CDs-based catalysts but also establishes a very promising catalytic oxidation system.
ABSTRACT
Previous studies suggest that TNFSF4 is a susceptibility gene of atherosclerosis. But case-control association analysis in Swedish population and German population provided inconsistent, even opposite results. In order to explore the relationship between this gene and coronary heart disease (CHD) in Chinese Han population, we collected 498 cases and 509 controls from Qilu hospital of Shandong University and analyzed the association between five single-nucleotide polymorphisms (SNPs) (rs1234314, rs45454293, rs3850641, rs1234313, and rs3861950) of TNFSF4 and CHD. On the basis of using traditional statistical analysis methods based on single SNP and haplotypes, we introduced principal component score-based logistic regression analysis to deal with the data. The results suggested that in Armitage trend test, only rs3861950 was significant, when used the Bonferroni correction, and all of the five SNPs were not statistically significant. In the logistic regression analysis which adjusts the confounding factors, all of the five SNPs were not statistically significant. In haplotype analysis, the frequencies of six haplotypes were significantly different in cases and controls (CTAGT (P=0.0006), CTAAC (P=0.0123), CCAGT (P=0.0004), GTGGT (P=0.0329), GCGAC (P<0.0001), and GCAAC (P=0.0173)). In principal component score-based logistic regression analysis, the first principal component has statistical significance (P=0.0236). These results indicate that TNFSF4 is a susceptibility gene of CHD in Chinese Han population.