Your browser doesn't support javascript.
loading
Show: 20 | 50 | 100
Results 1 - 14 de 14
Filter
1.
Phytother Res ; 22(6): 784-90, 2008 Jun.
Article in English | MEDLINE | ID: mdl-18389489

ABSTRACT

Casearia sylvestris Sw., popularly known in Brazil as 'guaçatonga', has been used as antitumor, antiseptic, antiulcer, local anaesthetic and healer in folk medicine. Snakebite envenomation by Bothrops jararacussu (Bjssu) constitutes a relevant public health hazard capable of inducing serious local damage in victims. This study examined the pharmacological action of apolar and polar C. sylvestris leaf extracts in reverting the neuromuscular blockade and myonecrosis, which is induced by Bjssu venom and its major toxin bothropstoxin-I on the mouse phrenic nerve-diaphragm preparations. The polar methanol extract (ME) was by far the most efficacious. ME not only prevented myonecrosis and abolished the blockade, but also increased ACh release. Such facilitation in neuromuscular transmission was observed with ME alone, but was accentuated in preparations incubated with ME plus venom or toxin. This established synergy opens an interesting point of investigation because the venom or toxin in contact with ME changes from a blocking to a facilitating effect. It is suggested that rutin, known to have potent antioxidant properties, and one of the components present in the ME, could have a role in the observed effects. Since commercial rutin did not reproduce the ME effects, it is likely that a rutin-containing phytocomplex is neutralizing the bothropic envenoming effects.


Subject(s)
Casearia/chemistry , Muscle Contraction/drug effects , Plant Extracts/pharmacology , Animals , Brazil , Chromatography, High Pressure Liquid , Chromatography, Thin Layer , Diaphragm/drug effects , Diaphragm/innervation , Diaphragm/physiology , In Vitro Techniques , Male , Methanol/chemistry , Mice , Neuromuscular Junction/drug effects , Neuromuscular Junction/physiology , Plant Extracts/chemistry
2.
Fitoterapia ; 79(5): 378-80, 2008 Jul.
Article in English | MEDLINE | ID: mdl-18505705

ABSTRACT

Ethanolic extract of leaves of Galactia glauscescens (GGE) at concentration of 100 and 500 microg/ml prevented the neuromuscular paralysis induced by Crotalus durissus terrificus venom on mouse phrenic nerve-diaphragm preparation.


Subject(s)
Crotalid Venoms/toxicity , Crotalus/physiology , Fabaceae/chemistry , Plant Extracts/pharmacology , Animals , Diaphragm/drug effects , Dose-Response Relationship, Drug , Male , Mice , Neuromuscular Blockade , Neuromuscular Junction/drug effects , Phrenic Nerve/drug effects , Plant Extracts/chemistry , Plant Leaves/chemistry
3.
Article in English | MEDLINE | ID: mdl-17401196

ABSTRACT

Crotoxin, a potent neurotoxin from the venom of the South American rattlesnake Crotalus durissus terrificus, exists as a heterodimer formed between a phospholipase A(2) and a catalytically inactive acidic phospholipase A(2) analogue (crotapotin). Large single crystals of the crotoxin complex and of the isolated subunits have been obtained. The crotoxin complex crystal belongs to the orthorhombic space group P2(1)2(1)2, with unit-cell parameters a = 38.2, b = 68.7, c = 84.2 A, and diffracted to 1.75 A resolution. The crystal of the phospholipase A(2) domain belongs to the hexagonal space group P6(1)22 (or its enantiomorph P6(5)22), with unit-cell parameters a = b = 38.7, c = 286.7 A, and diffracted to 2.6 A resolution. The crotapotin crystal diffracted to 2.3 A resolution; however, the highly diffuse diffraction pattern did not permit unambiguous assignment of the unit-cell parameters.


Subject(s)
Crotoxin/chemistry , Phospholipases A/chemistry , Crystallization , Crystallography, X-Ray , Dimerization , Phospholipases A2 , Protein Conformation
4.
Biochimie ; 88(5): 543-9, 2006 May.
Article in English | MEDLINE | ID: mdl-16376474

ABSTRACT

The electrophile Ca(2+) is an essential multifunctional co-factor in the phospholipase A(2) mediated hydrolysis of phospholipids. Crystal structures of an acidic phospholipase A(2) from the venom of Bothrops jararacussu have been determined both in the Ca(2+) free and bound states at 0.97 and 1.60 A resolutions, respectively. In the Ca(2+) bound state, the Ca(2+) ion is penta-coordinated by a distorted pyramidal cage of oxygen and nitrogen atoms that is significantly different to that observed in structures of other Group I/II phospholipases A(2). In the absence of Ca(2+), a water molecule occupies the position of the Ca(2+) ion and the side chain of Asp49 and the calcium-binding loop adopts a different conformation.


Subject(s)
Calcium/metabolism , Phospholipases A/chemistry , Phospholipases A/metabolism , Animals , Binding Sites , Bothrops/metabolism , Crotalid Venoms/enzymology , Crystallization , Crystallography, X-Ray/methods , Group IV Phospholipases A2 , Hydrogen Bonding , Models, Molecular , Phospholipases A2 , Protein Binding , Protein Structure, Secondary , Protein Structure, Tertiary
5.
Article in English | MEDLINE | ID: mdl-16880551

ABSTRACT

For the first time, a complete X-ray diffraction data set has been collected from a myotoxic Asp49-phospholipase A2 (Asp49-PLA2) with low catalytic activity (BthTX-II from Bothrops jararacussu venom) and a molecular-replacement solution has been obtained with a dimer in the asymmetric unit. The quaternary structure of BthTX-II resembles the myotoxin Asp49-PLA2 PrTX-III (piratoxin III from B. pirajai venom) and all non-catalytic and myotoxic dimeric Lys49-PLA2s. In contrast, the oligomeric structure of BthTX-II is different from the highly catalytic and non-myotoxic BthA-I (acidic PLA2 from B. jararacussu). Thus, comparison between these structures should add insight into the catalytic and myotoxic activities of bothropic PLA2s.


Subject(s)
Asparagine , Bothrops , Crotalid Venoms/toxicity , Phospholipases A/toxicity , Animals , Catalysis , Crotalid Venoms/chemistry , Crotalid Venoms/metabolism , Crystallography, X-Ray , Kinetics , Phospholipases A/chemistry , Phospholipases A/isolation & purification , Phospholipases A/metabolism , Phospholipases A2 , Protein Conformation
6.
Chem Biol Interact ; 235: 10-6, 2015 Jun 25.
Article in English | MEDLINE | ID: mdl-25868679

ABSTRACT

Parkinson's disease (PD) is the second most common neurodegenerative disorder; however, there is no treatment able to prevent the loss of dopaminergic neurons or its consequences. Trophic factors such as NGF and BDNF has positive effects on different disorders of the brain, including neurodegeneration. Additionally, studies have suggested the use of venom peptides as a therapeutic strategy for neurological disorders. Therefore, in the present study, we investigated the neuroprotective activity of a peptide isolated from Bothrops atrox venom and its trophic ability by using a cellular model of dopaminergic neurotoxicity induced by 1-methyl-4-phenylpyridinium (MPP(+)) in PC12 cells. We showed that it decreased the activities of the apoptotic proteases caspase-9 (mitochondrial) and caspase-3 (executor) and increased cell viability and proliferation in this model. Additionally, it increased neuritogenesis in non-treated PC12 cells (neuronal model) as well as in PC12 cells treated with the dopaminergic neurotoxin. The amino acid sequence of the peptide was identified as Glutamic acid-Valine-Tryptophan (Glu-Val-Trp). These findings suggest that this tripeptide has the potential to protect against the dopaminergic neurons loss and that trophic stimulation of neuroplasticity might be involved in its mechanism of neuroprotection.


Subject(s)
Bothrops/metabolism , Neuroprotective Agents/pharmacology , Parkinson Disease/drug therapy , Peptides/pharmacology , Venoms/pharmacology , 1-Methyl-4-phenylpyridinium/pharmacology , Animals , Apoptosis/drug effects , Caspase 3/metabolism , Caspase 9/metabolism , Cell Line, Tumor , Cell Proliferation/drug effects , Cell Survival/drug effects , Dopamine/metabolism , Dopaminergic Neurons/drug effects , Dopaminergic Neurons/metabolism , Glutamic Acid/pharmacology , Mitochondria/drug effects , Mitochondria/metabolism , Models, Biological , PC12 Cells , Parkinson Disease/metabolism , Rats , Tryptophan/pharmacology , Valine/pharmacology
7.
Biochimie ; 85(10): 983-91, 2003 Oct.
Article in English | MEDLINE | ID: mdl-14644553

ABSTRACT

Acidic phospholipase A(2) (PLA(2)) isoforms in snake venoms, particularly those from Bothrops jararacussu, have not been characterized. This article reports the isolation and partial biochemical, functional and structural characterization of four acidic PLA(2)s (designated SIIISPIIA, SIIISPIIB, SIIISPIIIA and SIIISPIIIB) from this venom. The single chain purified proteins contained 122 amino acid residues and seven disulfide bonds with approximate molecular masses of 15 kDa and isoelectric points of 5.3. The respective N-terminal sequences were: SIIISPIIA-SLWQFGKMIDYVMGEEGAKS; SIIISPIIB-SLWQFGKMIFYTGKNEPVLS; SIIISPIIIA-SLWQFGKMILYVMGGEGVKQ and SIIISPIIIB-SLWQFGKMIFYEMTGEGVL. Crystals of the acidic protein SIIISPIIB diffracted beyond 1.8 A resolution. These crystals are monoclinic with unit cell dimensions of a = 40.1 A, b = 54.2 A and c = 90.7 A. The crystal structure has been refined to a crystallographic residual of 16.1% (R(free) = 22.9%). Specific catalytic activity (U/mg) of the isolated acidic PLA(2)s were SIIISPIIA = 290.3 U/mg; SIIISPIIB = 279.0 U/mg; SIIISPIIIA = 270.7 U/mg and SIIISPIIIB = 96.5 U/mg. Although their myotoxic activity was low, SIIISPIIA, SIIISPIIB and SIIISPIIIA showed significant anticoagulant activity. However, there was no indirect hemolytic activity. SIIISPIIIB revealed no anticoagulant, but presented indirect hemolytic activity. With the exception of SIIISPIIB, which inhibited platelet aggregation, all the others were capable of inducing time-independent edema. Chemical modification with 4-bromophenacyl bromide did not inhibit the induction of edema, but did suppress other activities.


Subject(s)
Bothrops , Crotalid Venoms/enzymology , Phospholipases A/chemistry , Amino Acid Sequence , Animals , Creatine Kinase/metabolism , Crotalid Venoms/chemistry , Crotalid Venoms/toxicity , Crystallography, X-Ray , Edema/chemically induced , In Vitro Techniques , Isoenzymes/chemistry , Isoenzymes/isolation & purification , Isoenzymes/pharmacology , Mice , Models, Molecular , Molecular Sequence Data , Muscles/drug effects , Phospholipases A/isolation & purification , Phospholipases A/pharmacology , Phospholipases A/toxicity , Phospholipases A2 , Platelet Aggregation Inhibitors/chemistry , Platelet Aggregation Inhibitors/isolation & purification , Platelet Aggregation Inhibitors/pharmacology , Protein Conformation
8.
Toxicon ; 60(1): 70-82, 2012 Jul.
Article in English | MEDLINE | ID: mdl-22483847

ABSTRACT

The structures and functional activities of metalloproteinases from snake venoms have been widely studied because of the importance of these molecules in envenomation. Batroxase, which is a metalloproteinase isolated from Bothrops atrox (Pará) snake venom, was obtained by gel filtration and anion exchange chromatography. The enzyme is a single protein chain composed of 202 amino acid residues with a molecular mass of 22.9 kDa, as determined by mass spectrometry analysis, showing an isoelectric point of 7.5. The primary sequence analysis indicates that the proteinase contains a zinc ligand motif (HELGHNLGISH) and a sequence C164 I165M166 motif that is associated with a "Met-turn" structure. The protein lacks N-glycosylation sites and contains seven half cystine residues, six of which are conserved as pairs to form disulfide bridges. The three-dimensional structure of Batroxase was modeled based on the crystal structure of BmooMPα-I from Bothrops moojeni. The model revealed that the zinc binding site has a high structural similarity to the binding site of other metalloproteinases. Batroxase presented weak hemorrhagic activity, with a MHD of 10 µg, and was able to hydrolyze extracellular matrix components, such as type IV collagen and fibronectin. The toxin cleaves both α and ß-chains of the fibrinogen molecule, and it can be inhibited by EDTA, EGTA and ß-mercaptoethanol. Batroxase was able to dissolve fibrin clots independently of plasminogen activation. These results demonstrate that Batroxase is a zinc-dependent hemorrhagic metalloproteinase with fibrin(ogen)olytic and thrombolytic activity.


Subject(s)
Crotalid Venoms/enzymology , Fibrinolysis , Metalloproteases/metabolism , Amino Acid Sequence , Animals , Bothrops , Isoelectric Point , Mass Spectrometry , Metalloproteases/chemistry , Models, Molecular , Molecular Sequence Data , Sequence Homology, Amino Acid
9.
Toxicon ; 55(2-3): 361-8, 2010.
Article in English | MEDLINE | ID: mdl-19706302

ABSTRACT

Hemostatically active snake venom metalloproteinases (SVMPs) perturb the blood coagulation cascade at specific points and due to their potential application as thrombolytic agents, the fibrin(ogen)olytic non-hemorrhagic SVMPs have been employed as biochemical tools in coagulation research and diagnosis. Structural studies complemented by the design of metalloproteinase inhibitors have been instrumental in understanding their stereo specificity and action mechanism. We present here, details of the crystal structure of BmooMPalpha-I, a 22.6 kDa non-hemorrhagic P-I class SVMP isolated from Bothrops moojeni venom, determined at 1.76 A resolution. In this structure, the catalytic zinc ion displays an unusual octahedral coordination formed by the three canonical histidines (His(142), His(146) and His(152)) and additionally, by three solvent molecules. Comparative sequence and structural studies indicate that the motif comprising amino acid segments 153-164 and 167-176 adjacent to the methionine-turn is a salient feature that differentiates both non and hemorrhagic P-I class SVMPs and could directly be involved in the development of the hemorrhagic activity.


Subject(s)
Bothrops/physiology , Metalloproteases/chemistry , Viper Venoms/enzymology , Amino Acid Sequence , Animals , Crystallization , Electrophoresis, Polyacrylamide Gel , Hemorrhage/chemically induced , Metalloproteases/antagonists & inhibitors , Metalloproteases/pharmacology , Models, Molecular , Molecular Sequence Data , Protease Inhibitors/chemistry , Protease Inhibitors/pharmacology , Protein Binding , Protein Conformation , Spectrometry, Mass, Electrospray Ionization , Structure-Activity Relationship , Substrate Specificity , Viper Venoms/pharmacology , X-Ray Diffraction , Zinc/chemistry
10.
Toxicon ; 56(1): 86-92, 2010 Aug 01.
Article in English | MEDLINE | ID: mdl-20338188

ABSTRACT

The neurodegenerative diseases are important causes of morbidity and mortality in Western countries. Common mechanisms of toxicity involving mitochondrial damage have been suggested; however, a definitive treatment has not yet been found. Therefore, there has been great interest in the development of mitochondria-targeted protective compounds for the treatment of neuropathies. Animal toxins represent a promising source of new molecules with neuroprotective activity and potential to originate new drugs. We present here the effects of a low-molecular-mass peptides fraction (Ba-V) from Bothrops atrox snake venom, on rat brain mitochondrial function. Ba-V did not induce the mitochondrial swelling and moreover, was as effective as cyclosporin A (CsA) to inhibit the calcium/phosphate-induced swelling, which indicates its potential to prevent the mitochondrial permeability transition (MPT). The membrane electrochemical potential, the oxygen consumption during states-3 and -4 respirations as well as the respiratory control ratio (RCR) were not affected by Ba-V. Additionally, Ba-V did not induce reactive oxygen species (ROS) generation. Interestingly, Ba-V did not protect against the generation of ROS induced by t-BOH, which suggests a protection mechanism other than ROS scavenging. Given the important role of the mitochondrial damage and, more specifically, of MPT, in the development of neuropathies, Ba-V might be useful in the future strategies for the treatment of these diseases.


Subject(s)
Bothrops , Crotalid Venoms/chemistry , Mitochondrial Swelling/drug effects , Neuroprotective Agents/therapeutic use , Peptides/therapeutic use , Reptilian Proteins/therapeutic use , Animals , Brain , Brazil , Drug Evaluation, Preclinical , Hydrogen Peroxide/metabolism , Male , Membrane Potential, Mitochondrial/drug effects , Mitochondria/drug effects , Molecular Weight , Neurodegenerative Diseases/drug therapy , Neuroprotective Agents/adverse effects , Neuroprotective Agents/chemistry , Neuroprotective Agents/isolation & purification , Oxidative Phosphorylation/drug effects , Peptides/adverse effects , Peptides/chemistry , Peptides/isolation & purification , Permeability/drug effects , Rats , Rats, Wistar , Reactive Oxygen Species/metabolism , Reptilian Proteins/adverse effects , Reptilian Proteins/chemistry , Reptilian Proteins/isolation & purification
11.
Phytomedicine ; 12(1-2): 123-30, 2005 Jan.
Article in English | MEDLINE | ID: mdl-15693719

ABSTRACT

Partial neutralization of the myotoxic effect of Bothrops jararacussu venom (BV) and two of its myotoxins [bothropstoxin-I (BthTX-I), catalytically inactive, and II (BthTX-II), showing low PLA2 activity], by the lyophilized aqueous extract of Tabernaemontana catharinensis (AE), was studied in rat isolated soleus muscle preparations (in vitro) and through i.m. injection in the gastrocnemius muscle (in vivo) by determination of creatine kinase (CK) activity and histopathological analysis. Incubation of soleus muscle for 1 h with BV or toxins (20 microg/ml) plus AE (400 microg/ml) added immediately after BV, BthTX-I or BthTX-II reduced CK levels by 53%, 37% and 56%, respectively. The myonecrotic effects of BV (20 microg/ml) upon soleus muscle was reduced 24%, 35% and 36% when AE (400 microg/ml) was added 1 h after BV and CK was evaluated 30 min, 1 and 2 h later, respectively. For BthTX-I these values were 46%, 48% and 47%, while for BthTX-II no inhibitory effect was detected. Histological analysis of soleus muscle after incubation with AE (400 microg/ml, 1 h) did not reveal any change in muscle fibers, but severe necrosis induced by BV or toxins (20 microg/ml) was clearly in evidence, and decreased significantly when soleus muscle was protected by AE. This protection was also observed when AE was administered 1 h after BV or BthTX-I, but not after BthTX-II. AE did not inhibit the catalytic PLA2 activity of BthTX-II or BV and did not change the PAGE pattern of BV, BthTX-I or BthTX-II. In vivo assays were performed in 100-g rats and maximal CK release was attained at a dose of 100 microg of BV, 3 h after injection. AE was not effective when injected 20 s after BV or toxins. However, injecting BV or toxins (100 microg), which were pre-incubated with AE (2 mg) caused an inhibition of 57%, 59% and 51%, respectively, with zero time pre-incubation, but was less effective with 1 h pre-incubation. This plant represents a potential source of promising myotoxin inhibitors.


Subject(s)
Antivenins/pharmacology , Bothrops , Crotalid Venoms/antagonists & inhibitors , Phytotherapy , Plant Extracts/pharmacology , Tabernaemontana , Animals , Antivenins/administration & dosage , Antivenins/therapeutic use , Creatine Kinase/metabolism , Crotalid Venoms/chemistry , Crotalid Venoms/toxicity , Muscle, Skeletal/drug effects , Muscle, Skeletal/enzymology , Plant Extracts/administration & dosage , Plant Extracts/therapeutic use , Plant Roots , Rats , Rats, Wistar
12.
Acta Crystallogr D Biol Crystallogr ; 59(Pt 10): 1813-5, 2003 Oct.
Article in English | MEDLINE | ID: mdl-14501123

ABSTRACT

Convulxin, an alphabeta C-type lectin, is a potent platelet activator isolated from the venom of the South American rattlesnake Crotalus durissus terrificus. It is a 26.5 kDa alphabeta heterodimer consisting of two homologous disulfide-linked chains. The crystals belong to space group I4, with unit-cell parameters a = b = 131.61, c = 121.85 A, and diffraction data were collected to 2.7 A. The structure was solved by molecular replacement and the asymmetric unit contains two alphabeta heterodimers, each of which forms a disulfide-linked cyclic alpha(4)beta(4) tetramer in the unit cell. These alpha(4)beta(4) tetramers are stacked to form a large solvent channel.


Subject(s)
Crotalid Venoms/chemistry , Lectins, C-Type/chemistry , Animals , Crotalus , Crystallization , Crystallography, X-Ray , Disulfides/chemistry , Models, Molecular , Protein Structure, Quaternary , Protein Subunits
13.
Biochem Biophys Res Commun ; 310(2): 478-82, 2003 Oct 17.
Article in English | MEDLINE | ID: mdl-14521935

ABSTRACT

Convulxin (CVX), a C-type lectin, isolated from the venom of the South American rattlesnake Crotalus durissus terrificus, causes cardiovascular and respiratory disturbances and is a potent platelet activator which binds to platelet glycoprotein GPVI. The structure of CVX has been solved at 2.4A resolution to a crystallographic residual of 18.6% (R(free)=26.4%). CVX is a disulfide linked heterodimer consisting of homologous alpha and beta chains. The heterodimers are additionally linked by disulfide bridges to form cyclic alpha(4)beta(4)heterotetramers. These domains exhibit significant homology to the carbohydrate-binding domains of C-type lectins, to the factor IX-binding protein (IX-bp), and to flavocetin-A (Fl-A) but sequence and structural differences are observed in both the domains in the putative Ca(2+)and carbohydrate binding regions.


Subject(s)
Crotalid Venoms/chemistry , Crotalus , Lectins, C-Type/chemistry , Models, Molecular , Amino Acid Sequence , Animals , Binding Sites , Calcium/metabolism , Crotalid Venoms/metabolism , Crystallography, X-Ray , Disulfides/chemistry , Lectins, C-Type/metabolism , Molecular Sequence Data , Protein Structure, Quaternary , Protein Subunits , Sequence Alignment
14.
J. venom. anim. toxins incl. trop. dis ; J. venom. anim. toxins incl. trop. dis;11(4): 465-478, out.-dez. 2005. graf
Article in English | LILACS | ID: lil-417720

ABSTRACT

Numerous plants are used as snakebite antidotes in Brazilian folk medicine, including Casearia sylvestris Swartz, popularly known as guaçatonga. In this study, we examined the action of a hydroalcoholic extract from C. sylvestris on the neuromuscular blockade caused by bothropstoxin-I (BthTX-I), a myotoxin from Bothrops jararacussu venom, in mouse isolated phrenic nerve-diaphragm (PND) preparations. Aqueous (8 and 12 mg/ml, n=4 and 5, respectively) and hydroalcoholic (12 mg/ml, n=12) extracts of the leaves of C. sylvestris caused facilitation in PND preparations followed by partial neuromuscular blockade. BthTX-I (20 mg/ml, n=4) caused 50% paralysis after 65±15 min (mean ± S.E.M). Preincubation (30 min at 37°C) of BthTX-I (20 mg/ml, n=4) with a concentration of the hydroalcoholic extract (4 mg/ml) that had no neuromuscular activity, such as the control (n=5), prevented the neuromuscular blockade caused by the toxin. This protection may be mediated by compounds such as flavonoids and phenols identified by thin-layer chromatography and colorimetric assays


Subject(s)
Animals , Male , Mice , Plant Extracts/therapeutic use , Plants, Medicinal , Snake Bites , Snake Venoms , Neuromuscular Blockade
SELECTION OF CITATIONS
SEARCH DETAIL