Your browser doesn't support javascript.
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 44
Filtrar
Mais filtros










Filtros aplicados

Intervalo de ano de publicação
1.
Araçatuba; s.n; 2019. 114 p. tab, graf, ilus.
Tese em Inglês, Português | LILACS, BBO - Odontologia | ID: biblio-1051133

RESUMO

Este trabalho foi dividido em dois capítulos que objetivou avaliar: 1) o efeito isolado ou combinado do flavonoide epigallocatechin-3-gallate (EGCG) em associação com o peptídeo LL-37 e seu análogo KR-12-a5 sobre a viabilidade celular de fibroblastos e sobre cultura planctônica, biofilme simples, dual-espécies e túbulos dentináios e 2) as interações sinérgicas do EGCG e proantocianidina do oxicoco (A-type cranberry proanthocyanidins, AC-PAC), quando usado em combinação com LL-37 ou KR-12-a5 sobre a viabilidade celular, a capacidade de migração e inibição das citocinas em cultura de fibroblastos (HGF-1), quando estimuladas ou não pelo lipopolissacarídeo de A. actinomycetencomitans (LPS). No capítulo 1, a concentração inibitória mínima (MIC), a concentração bactericida mínima (MBC) e concentração inibitória fracionária (FIC) de EGCG, LL-37 e KR-12-a5 foram determinadas a partir de valores decrescentes dos compostos por meio dos métodos de microdiluição e checkerboard contra Streptococcus mutans, Enterococcus faecalis, Actinomyces israelii e Fusobacterium nucleatum após 24 horas de tratamento. Fibroblastos da linhagem L-929 foram expostos a combinações de EGCG com peptídeos em diferentes concentrações e o metabolismo celular avaliado por ensaios de MTT. Os compostos com melhor efeito antimicrobiano e citotóxico foram avaliados por 24-36h, isoladamente ou em combinação, em biofilmes individuais ou biofilmes de dual-espécies com E. faecalis formados em placas de poliestireno por 48h por meio de contagem bacteriana. Os biofilmes de E. faecalis também foram cultivados em túbulos dentinários por 2 semanas, tratados com EGCG, KR-12-a5 e EGCG + KR-12-a5 e a porcentagem de células mortas foi determinada pela análise de imagens usando Microscopia Confocal. No capítulo 2, a linhagem celular de fibroblastos gengivais humanos primários HGF-1 foi pré-tratada durante 2 h com EGCG ou AC-PAC a 25 e 12,5 µg / mL, LL-37 ou KR-12-a5 a 0,06 e 0,03 µM ou com uma combinação de EGCG + ACPAC; AC-PAC + KR-12-a5; AC-PAC + LL-37; EGCG + KR-12-a5 ou EGCG + LL-37, nas mesmas concentrações. As culturas celulares foram então estimuladas com 50 µg/mL de LPS por 24-48h. A viabilidade celular e migração foram analisadas usando ensaios colorimétricos e fluorescentes, respectivamente. A quantificação de citocinas foi determinada por ensaios multiplex ELISA. Os resultados mostraram que em condições planctônicas, EGCG + KR-12-a5 apresentaram efeito sinérgico ou aditivo contra todas as bactérias testadas, com FIC menor que os valores de MIC obtidos pelos compostos isolados. As combinações de EGCG e peptídeos testados não foram tóxicas para os fibroblastos, uma vez que o crescimento celular foi superior a 70%. Em condições de biofilme simples, EGCG + KR-12-a5 eliminou S. mutans e A. israelii e reduziu E. faecalis e F. nucleatum. Para biofilmes de duas espécies, quando E. faecalis foi combinado com S. mutans, EGCG + KR-12-a5 teve efeito sinérgico eliminando S. mutans e reduzindo estatisticamente as contagens de E. faecalis. Em biofilmes associando E. faecalis e A. israelii ou F. nucleatum, EGCG + KR-12-a5 eliminaram E. faecalis e promoveram redução de A. israelii e F. nucleatum, embora não tenha sido observada diferença estatística entre os compostos. EGCG + KR-12-a5 reduziu mais de 80% dos biofilmes de E. faecalis nos túbulos dentinários. Dentre os grupos experimentais estudados, o EGCG, principalmente a 25 e 12,5 µg/mL estimulou o crescimento de fibroblastos, protegendo-os dos efeitos do LPS. Efeito sinérgico entre EGCG + AC-PAC, EGCG + LL-37 e EGCG + KR-12-a5 no metabolismo celular também foi observado na presença de LPS. Combinações do EGCG com AC-PAC ou KR-12-a5 e AC-PAC com LL-37 foram capazes de aumentar estatisticamente a migração celular. EGCG, AC-PAC, LL-37 e KR-12-a5 promoveram a redução de citocinas individualmente ou em combinação (EGCG + AC-PAC e EGCG + KR12-a5) mais especificamente para IL-6, IL-8, GM- CSF e TNF-α. Conclui-se que a associação de EGCG e KR-12-a5 é citocompatível e promove um efeito sinérgico contra bactérias associadas a infecções endodônticas, sob condições planctônicas e de biofilme. O EGCG, isoladamente ou associado ao AC-PAC e ao KR-12-a5, aumenta a viabilidade e migração celular, bem como a inibição de citocinas por fibroblastos estimulados por LPS. A associação de EGCG com KR-12-a5 poderia ser uma opção de princípio ativo em medicações para fins endodônticos(AU)


This study was divided in two chapters that aimed to evaluate: 1) the effect of flavonoid epigallocatechin-3-gallate (EGCG), cationic peptide LL-37 peptide and its analogue KR12-a5, alone or in combination, on fibroblast cell viability and on bacteria in planktonic and single/dual-species biofilms/dentin tubules; 2) the synergistic interactions of EGCG and cranberry proanthocyanidins (A-type cranberry proanthocyanidins, AC-PAC), when used in combination with LL-37 or KR-12-a5 on cell viability, the ability to induce cell migration and inhibit cytokines in culture of fibroblasts (HGF-1) when stimulated or not by the lipopolysaccharide of A. actinomycetencomitans (LPS). For the chapter 1, Minimum inhibitory concentration (MIC), minimum bactericidal concentration (MBC) and fractional inhibitory concentration (FIC) of EGCG, LL-37 and KR-12-a5 were determined from decreasing values of the compounds by Streptococcus mutans, Enterococcus faecalis, Actinomyces israelii and Fusobacterium nucleatum against microdilution and checkerboard after 24 hours of treatment. L-929 fibroblasts were exposed to combinations of EGCG with peptides at different concentrations and cell metabolism assessed by MTT assays. The compounds if the best antimicrobial and cytotoxic effect were also evaluated for 24-36h, alone or in combination, in 48h singleor dual-species biofilms with E. faecalis formed on polystyrene plates by bacterial counting. E. faecalis biofilms were also cultured in dentin tubules for 2 weeks and treated with EGCG, KR-12-a5 and EGCG + KR-12-a5 to determine the percentage of dead cells by analysis of images using Confocal Microscopy. For the chaper 2, primary human gingival fibroblast HGF-1 cell line was pretreated for 2 h with either EGCG or AC-PAC at 25 and 12.5 µg/mL, LL-37 or KR-12-a5 at 0.03 and 0.06 µM or with a combination of EGCG + AC-PAC; AC-PAC + KR-12-a5; AC-PAC + LL-37; EGCG + KR-12-a5 or EGCG + LL37, at the same concentrations. Cell cultures were then stimulated with 50 µg/mL LPS for 24-48h. Cell viability and migration were analyzed using colorimetric and fluorescent assays, respectively. Quantification of cytokines was determined by multiplex ELISA assays. The results show that in planktonic conditions, EGCG + KR-12- a5 showed a synergistic or additive effect against all the bacteria tested, with FIC lower than the MIC values obtained by the compounds alone. Combinations of EGCG and peptides tested were not toxic to fibroblasts, since cell growth was higher than 70%. Under single biofilm conditions, EGCG + KR-12-a5 eliminated S. mutans and A. israelii and reduced E. faecalis and F. nucleatum. For dual- species biofilms, when E. faecalis was combined with S. mutans, EGCG + KR-12-a5 had a synergistic effect by eliminating S. mutans and statistically reducing E. faecalis counts. In biofilms associated with E. faecalis and A. israelii or F. nucleatum, EGCG + KR-12-a5 eliminated E. faecalis and promoted reduction of A. israelii and F. nucleatum, although no statistical difference was observed between the compounds. EGCG + KR-12-a5 reduced more than 80% of the E. faecalis biofilms in the dentin tubules. Among the experimental groups studied, EGCG, mainly at 25 and 12.5 µg/mL stimulated the growth of fibroblasts, protecting them from the effects of LPS. Synergistic effect between EGCG + AC-PAC, EGCG + LL-37 and EGCG + KR12-a5 on cell metabolism was also observed in the presence of LPS. Combinations of EGCG with AC-PAC or KR-12-a5 and AC-PAC with LL-37 were able to increase statistically cell migration. EGCG, AC-PAC, LL-37 and KR-12-α5 promoted cytokine reduction individually or in combination (EGCG + AC-PAC and EGCG + KR-12-a5) more specifically for IL-6, IL-8, GM-CSF and TNF-α. The association of EGCG and KR-12-a5 was cytocompatible and promoted a synergistic effect against bacteria associated with endodontic infections under planktonic and biofilm conditions. EGCG, alone or in combination with AC-PAC and KR-12-a5, increases cell viability and migration, as well as inhibition of cytokines by LPS-stimulated fibroblasts. The association of EGCG with KR12-a5 could be an option as active principle for medications to be used for endodontic purposes(AU)


Assuntos
Flavonoides , Biofilmes , Peptídeos Catiônicos Antimicrobianos , Citocinas , Fibroblastos
2.
J. bras. pneumol ; 45(4): e20190001, 2019. tab, graf
Artigo em Português | LILACS | ID: biblio-1019982

RESUMO

RESUMO Objetivo Este estudo teve como objetivo determinar os níveis séricos de proteína 3 contendo um domínio NACHT, porção C-terminal rica em repetições de leucina e de domínio pirina (NLRP3) e catelicidina LL-37, bem como investigar sua importância prognóstica em pneumonia adquirida na comunidade (PAC). Métodos Este estudo prospectivo incluiu 76 pacientes com PAC. Foram obtidos dados demográficos e características clínicas. Os níveis séricos de NLRP3 e LL-37 foram determinados por meio do teste ELISA. A correlação entre NLRP3 e LL-37 foi estimada por intermédio da análise de Spearman. A associação entre NLRP3 e LL-37 com 30 dias de taxa de sobrevida e de mortalidade foi avaliada pela curva de Kaplan-Meier e análise de regressão logística. Resultados Os níveis séricos de NLRP3 estavam elevados, enquanto os níveis de LL-37 apresentaram redução significativa em pacientes com PAC grave. Observou-se correlação significativa entre os níveis séricos de NLRP3 e LL-37 em pacientes com PAC. Pacientes com níveis elevados de NLRP3 e níveis reduzidos de LL-37 exibiram maior taxa de sobrevida em 30 dias e de mortalidade quando comparados com aqueles com níveis inferiores de NLRP3 e LL-37. Conclusões Pacientes com PAC grave tendem a apresentar níveis séricos elevados de NLRP3 e níveis reduzidos de LL-37, o que pode ser utilizado como um potencial biomarcador prognóstico.


ABSTRACT Objective This study aimed to determine the serum levels of NACHT, Leucine-rich repeat (LRR), and Pyrin (PYD) domains-containing Protein 3 (NLRP3) and cathelicidin LL-37, and investigate their prognostic significance in community-acquired pneumonia (CAP). Methods The sample of this prospective study was composed of 76 consecutive patients with CAP. Demographic data and clinical characteristics were collected. Serum levels of NLRP3 and LL-37 were determined by ELISA. Spearman's analysis was used to evaluate the correlation between NLRP3 and LL-37. Association of NLRP3 and LL-37 with 30-day survival and mortality rates was assessed using the Kaplan-Meier curve and logistic regression analysis. Results Serum NLRP3 significantly increased whereas serum LL-37 significantly decreased in patients with severe CAP. Significant correlation was observed between serum NLRP3 and LL-37 in CAP patients. Patients with higher levels of NLRP3 and lower levels of LL-37 showed lower 30-day survival rate and higher mortality compared with those with lower NLRP3 and higher LL-37 levels. Conclusion Severe CAP patients tend to present higher serum NLRP3 and lower serum LL-37, which might serve as potential biomarkers for CAP prognosis.


Assuntos
Humanos , Masculino , Feminino , Pessoa de Meia-Idade , Idoso , Pneumonia/sangue , Proteínas/análise , Infecções Comunitárias Adquiridas/sangue , Peptídeos Catiônicos Antimicrobianos/sangue , Proteína 3 que Contém Domínio de Pirina da Família NLR/sangue , Pirina/sangue , Pneumonia/mortalidade , Biomarcadores/sangue , Estudos de Casos e Controles , Modelos Logísticos , Análise Multivariada , Valor Preditivo dos Testes , Estudos Prospectivos , Infecções Comunitárias Adquiridas/mortalidade , Estimativa de Kaplan-Meier
3.
ImplantNewsPerio ; 3(2): 324-334, mar.-abr. 2018. ilus, tab
Artigo em Português | LILACS, BBO - Odontologia | ID: biblio-883519

RESUMO

Objetivo: realizar um levantamento sistemático da literatura no que tange ao uso de peptídeos antimicrobianos contra periodontopatógenos e indicar quais os peptídeos e micro-organismos mais estudados, com o objetivo final de traçar um perfil das publicações na área. Material e métodos: a busca por artigos ocorreu na base de dados Pubmed, com os seguintes critérios de inclusão: publicação nos últimos dez anos; palavras-chave "Antimicrobial Peptide" and "Periodontal" and "Bacteria", publicados em inglês e disponíveis gratuitamente na íntegra para leitura. Um total de dez artigos foram selecionados após o refinamento dos dados. Resultados: apesar do pequeno número de estudos encontrados, evidencia-se o potencial uso de peptídeos antimicrobianos no controle das principais bactérias periodontopatogênicas. Além disso, os peptídeos produzidos por células da mucosa oral (Defensinas, LL-37 e Histatinas), bem como os micro-organismos Porphyromonas gingivalis e Fusobacterium nucleatum, foram os mais estudados. Conclusão: é possível concluir que o uso de peptídeos antimicrobianos como potencial ferramenta no controle microbiano tem uma importância crescente, provavelmente devido à sua ampla aplicabilidade, mecanismos de ação e baixos índices de resistência. Contudo, estudos relacionados à sua toxicidade sobre células humanas, modo de aplicação e ensaios clínicos precisam ser realizados.


Objectives: to perform a systematic review of the literature regarding the use of antimicrobial peptides against periodontopathogens and indicate the most studied peptides and microorganisms, with the final objective of outlining a profile of publications in the area. Material and methods: the search for articles occurred in Pubmed database with the following inclusion criteria: publication in the last 10 years; Keywords "Antimicrobial Peptide" and "Periodontal" and "Bacteria", published in English and freely available for reading. Results: a total of 10 articles were selected after refi ning the data. Despite the small number of studies found, it is evident the potential use of antimicrobial peptides in the control of the main periodontopathogenic bacteria. In addition, the peptides produced by oral mucosa cells (Defensins, LL-37 and Histatins) as well as the microorganisms Porphyromonas gingivalis and Fusobacterium nucleatum were the most studied. Conclusion: it is possible to conclude that the use of antimicrobial peptides as a tool in microbial control is of increasing importance, probably due to their wide applicability, mechanisms of action and low resistance indices. However, studies related to its toxicity on human cells, mode of application and clinical trials still need to be performed.


Assuntos
Peptídeos Catiônicos Antimicrobianos , Peptídeos Catiônicos Antimicrobianos/uso terapêutico , Biofilmes/crescimento & desenvolvimento , Doenças Periodontais
4.
Braz. j. microbiol ; 49(supl.1): 213-219, 2018. tab, graf
Artigo em Inglês | LILACS | ID: biblio-974341

RESUMO

ABSTRACT Background: Cerebrospinal fluid bacterial culture is the gold-standard for confirmation of acute bacterial meningitis, but many cases are not culture confirmed. Antibiotics reduce the chance of a microbiological diagnosis. Objective to evaluate efficacy of Heparin-binding protein in diagnosis of bacterial meningitis. Patients: 30 patients diagnosed with acute bacterial meningitis, 30 viral meningitis, and 30 subjects with normal CSF findings. Design: Diagnosis was based on history, clinical criteria, CSF examination, latex agglutination & culture, and sensitivities and response to therapy. HBP was measured using enzyme-linked immunosorbent technique in both serum & CSF. Results: Cerebrospinal fluid HBP levels averaged 0.82 ± 0.3 ng/mL in controls, 3.3 ± 1.7 ng/mL in viral and 174.8 ± 46.7 ng/mL in bacterial meningitis. Mean serum level was 0.84 ± 0.3 ng/mL in the controls, 3.7 ± 1.9 ng/mL in viral, and 192.2 ± 56.6 ng/mL in bacterial meningitis. Both HBP levels were significantly higher in patients with bacterial meningitis. Cut-offs of 56.7 ng/ml and 45.3 ng/ml in cerebrospinal fluid & serum showed 100% overall accuracy. Even in patients who received prior antibiotics, remained elevated. Conclusion: Serum Heparin-binding protein serves as a non-invasive potential marker of acute bacterial meningitis even in partially treated cases.


Assuntos
Humanos , Masculino , Feminino , Lactente , Pré-Escolar , Criança , Adolescente , Adulto , Adulto Jovem , Proteínas Sanguíneas/líquido cefalorraquidiano , Heparina/metabolismo , Proteínas de Transporte/líquido cefalorraquidiano , Proteínas de Transporte/sangue , Meningites Bacterianas/diagnóstico , Peptídeos Catiônicos Antimicrobianos/líquido cefalorraquidiano , Peptídeos Catiônicos Antimicrobianos/sangue , Biomarcadores/líquido cefalorraquidiano , Biomarcadores/sangue , Estudos Transversais , Meningites Bacterianas/líquido cefalorraquidiano , Meningites Bacterianas/microbiologia , Meningites Bacterianas/sangue , Pessoa de Meia-Idade
5.
Braz. j. microbiol ; 48(4): 809-814, Oct.-Dec. 2017. graf
Artigo em Inglês | LILACS | ID: biblio-889176

RESUMO

ABSTRACT This study aimed to describe a Bacillus subtilis expression system based on genetically modified B. subtilis. Abaecin, an antimicrobial peptide obtained from Apis mellifera, can enhance the effect of pore-forming peptides from other species on the inhibition of bacterial growth. For the exogenous expression, the abaecin gene was fused with a tobacco etch virus protease cleavage site, a promoter Pglv, and a mature beta-glucanase signal peptide. Also, a B. subtilis expression system was constructed. The recombinant abaecin gene was expressed and purified as a recombinant protein in the culture supernatant. The purified abaecin did not inhibit the growth of Escherichia coli strain K88. Cecropin A and hymenoptaecin exhibited potent bactericidal activities at concentrations of 1 and 1.5 µM. Combinatorial assays revealed that cecropin A and hymenoptaecin had sublethal concentrations of 0.3 and 0.5 µM. This potentiating functional interaction represents a promising therapeutic strategy. It provides an opportunity to address the rising threat of multidrug-resistant pathogens that are recalcitrant to conventional antibiotics.


Assuntos
Peptídeos Catiônicos Antimicrobianos/genética , Peptídeos Catiônicos Antimicrobianos/metabolismo , Bacillus subtilis/genética , Vetores Genéticos/genética , Proteínas de Insetos/genética , Proteínas de Insetos/metabolismo , Antibacterianos/isolamento & purificação , Antibacterianos/metabolismo , Antibacterianos/farmacologia , Peptídeos Catiônicos Antimicrobianos/isolamento & purificação , Peptídeos Catiônicos Antimicrobianos/farmacologia , Bacillus subtilis/metabolismo , Escherichia coli/efeitos dos fármacos , Escherichia coli/crescimento & desenvolvimento , Expressão Gênica , Vetores Genéticos/metabolismo , Proteínas de Insetos/isolamento & purificação , Proteínas de Insetos/farmacologia , Engenharia de Proteínas , Transporte Proteico , Proteínas Recombinantes/genética , Proteínas Recombinantes/isolamento & purificação , Proteínas Recombinantes/metabolismo , Proteínas Recombinantes/farmacologia
6.
Araçatuba; s.n; 2017. 83 p. graf, tab, ilus.
Tese em Inglês, Português | LILACS, BBO - Odontologia | ID: biblio-911426

RESUMO

O uso de agentes antimicrobianos naturais que reduzam a adesão e proliferação de S. mutans no biofilme poderia ser uma estratégia interessante para o controle da cárie dentária. No entanto, a estabilidade química e física de alguns desses agentes, como os peptídeos catiônicos antimicrobianos e fragmentos de peptídeos, pode ser comprometida por fatores externos, como temperatura e pH, reduzindo sua ação antimicrobiana. Com isso, os objetivos deste estudo foram desenvolver e caracterizar sistemas de liberação de fármaco nanoestruturados bioadesivos para a incorporação dos fragmentos peptídicos D1-23 e P1025 e avaliar seu efeito citotóxico e atividade contra biofilme de S. mutans. A primeira formulação (F1), composta de ácido oleico, polyoxypropylene-(5)-polyoxyethylene-(20)-cetyl alcohol (PPCA), Carbopol® 974P e Carbopol® 971P, foi analisada por microscopia de luz polarizada (MLP), reologia e bioadesão in vitro. A concentração inibitória mínima (CIM) e concentração bactericida mínima (CBM) de D1-23 foram determinadas contra S. mutans para posterior avaliação da atividade sobre biofilme formado após 4h e 24h de tratamento. A segunda formulação (F2) foi selecionada a partir de três diferentes concentrações de ácido oleico, PPCA e Carbopol® 974P. Cada formulação foi analisada por MLP, espalhamento de raios x a baixo ângulo (SAXS), reologia e bioadesão. CIM e CBM de P1025 sobre S. mutans e seu efeito quando incorporado ou não em F2 sobre biofilme de S. mutans em formação foram analisados. A citotoxicidade em células epiteliais HaCat foi avaliada para os dois sistemas líquido cristalino (SLC) usando testes de MTT. Análise descritiva foi realizada para os dados dos ensaios de caracterização e para os ensaios microbiológicos e citotóxicos os dados foram submetidos aos testes de ANOVA/Tukey ou Kruskall-Wallis/Mann-Whitney U (p<0.05). Os resultados indicaram que F1 apresentou características de SLC com alta viscosidade e bioadesão. CIM e CBM de D1-23 foram de 15,60 e 31,25µg/mL, respectivamente. D1-23 incorporado em F1 apresentou melhores resultados contra biofilme de S. mutans que quando em solução, após 24h de tratamento. F2 apresentou melhores propriedades reológicas e força bioadesiva comparada aos demais sistemas, caracterizando um SLC. P1025 teve somente efeito inibitório sobre S. mutans (CIM=0.25 mg/mL). O efeito antibiofilme de P1025 incorporado em F2 foi observado após 24h de tratamento, principalmente quando aplicado na fase de adesão. Ambos os SLC contendo D1-23 e P1025 não apresentaram toxicidade sobre as células epiteliais, nas condições de tempo e concentrações avaliadas. A incorporação de peptídeos em SLC bioadesivos nanoestruturados aumenta suas propriedades antimicrobianas, podendo ser uma interessante estratégia para a prevenção da cárie dentária(AU)


The use of natural antimicrobial agents for reducing the adhesion and proliferation of S. mutans in the biofilm could be an interesting strategy for the control of dental caries. However, the chemical and physical stability of some natural antimicrobials, such as cationic antimicrobial peptides and peptide fragments, can be compromised by external factors such as temperature and pH, reducing their antimicrobial action. Thus, the objectives of this study were to develop and characterize nanostructured bioadhesive drug delivery systems for the incorporation of D1-23 and P1025 peptide fragments and to evaluate their citotoxicy and activity against S. mutans biofilm. The first formulation (F1) was composed of oleic acid, polyoxypropylene- (5) -polyoxyethylene- (20) - cetyl alcohol (PPCA), Carbopol® 974P and Carbopol® 971P and analyzed by polarized light microscopy (PLM), rheology and in vitro bioadhesion. Minimum inhibitory concentration (MIC) and minimal bacterial concentration (MBC) of D1-23 were determined against S. mutans for further evaluation of activity against S. mutans biofilm after 4h and 24h of treatment. The second formulation was selected from three different concentrations of oleic acid, PPCA and Carbopol® 974P. Each formulation was analyzed by PLM, small-angle x-ray scattering (SAXS), rheology and bioadhesion. MIC and MBC of P1025 were determined against S. mutans. Thus, P1025 was incorporated in the best formulation (F2). The effect of P1025 incorporated or not into F2 on S. mutans biofilm formation was analyzed. Cytotoxicity in HaCat epithelial cells for both formulations was evaluated using MTT assays. Descriptive analysis was performed for the characterization assays and data from microbiological and cytotoxic assays were submitted to ANOVA / Tukey or Kruskall-Wallis / Mann-Whitney U (p<0.05). The results indicated that F1 presented characteristics of liquid-crystalline type system (LCS) with high viscosity and bioadhesion. The MIC and MBC of D1-23 were 15.60 and 31.25µg / mL, respectively. D1-23 incorporated in F1 showed better results than D1-23 in solution against S. mutans biofilm after 24h. F2 had better rheological properties and bioadhesive strength compared to other systems analyzed and characteristics of LCS. P1025 had only inhibitory effect against S. mutans (MIC=0.25mg/mL). The antibiofilm effect of P1025 incorporated into F2 was observed after 24h of treatment, mainly when applied in surface-bound salivary phase. Both LCS had no toxicity on epithelial cells, considering time and concentrations tested. The incorporation of peptides in nanostructured bioadhesive LCS increased their antimicrobial properties and could be an interesting strategy for caries prevention(AU)


Assuntos
Peptídeos Catiônicos Antimicrobianos , Cárie Dentária , Streptococcus mutans , Biofilmes , Sistemas de Liberação de Medicamentos
7.
Artigo em Espanhol | LILACS | ID: biblio-844743

RESUMO

En la actualidad existe consenso en que el daño de los tejidos de soporte dentario que se produce durante la periodontitis es un proceso complejo en el cual la presencia de los patógenos periodontales es necesaria, pero no suficiente, para explicar en su totalidad la extensión y severidad de dicho daño. Asimismo, la destrucción del tejido de soporte periodontal es en gran medida producida por el desbalance de la respuesta inmune generada por el paciente frente a antígenos y factores de virulencia derivados de los patógenos periodontales. Esta respuesta inmune, desencadenada por las bacterias periodontopatógenas, incluye tanto mecanismos asociados a inmunidad innata como adaptativa, siendo el rol de los péptidos antimicrobianos y mediadores lipídicos aspectos relacionados con ambas ramas de la inmunidad y que no han sido completamente dilucidados en relación con sus mecanismos de acción contra los patógenos periodontales. En esta revisión se describe el rol de los péptidos antimicrobianos y de los mediadores lipídicos en la enfermedad periodontal, enfocándonos en su contribución tanto a la protección como a la destrucción del tejido de soporte dentario durante la infección periodontal. Se destaca además la importancia de considerarlos dentro del complejo escenario de la respuesta inmune durante las enfermedades periodontales, ya que forman parte fundamental de la respuesta inmune del hospedero. Analizar la enfermedad periodontal ampliando la perspectiva de estudio a este tipo de moléculas que participan de la respuesta inmune permitiría en el futuro lograr un nuevo enfoque terapéutico de las enfermedades periodontales.


Currently, there is consensus that the damage of the tooth support tissues that occurs during periodontitis is a complex mechanism, in which the presence of specific periodontal pathogens is necessary, but not sufficient, to fully explain the extent and severity of the observed periodontal destruction. Moreover, the destruction of periodontal support tissue is largely the effect of the imbalance in the patient immune response, triggered by periodontal pathogen-derived antigens and virulence factors. The immune response elicited by periodontal pathogenic bacteria includes mechanisms associated with both innate and adaptive responses, where the role of antimicrobial peptides and lipid mediators are related to these two arms of immunity, and have not been fully elucidated in relation to their mechanisms of action against periodontal pathogens. In this review, a discussion is presented on the characteristics of these molecules and their role in periodontal disease in relation to both protection and destruction of tooth supporting tissue during periodontal infection. The relevance of considering these mediators within the complex scenario of the immune response during periodontal diseases is also highlighted, since they are a fundamental part of the host immune response. Periodontal diseases should be analysed in a broader perspective, where the study of these types of molecules involved in the immune response of periodontal tissues, may help to develop new therapeutic approaches to periodontal diseases in the future.


Assuntos
Humanos , Peptídeos Catiônicos Antimicrobianos/imunologia , Ácidos Docosa-Hexaenoicos/imunologia , Doenças Periodontais/imunologia , Defensinas/imunologia
8.
São Paulo; s.n; 2016. [124] p. ilus, graf, tab.
Tese em Português | LILACS | ID: biblio-870892

RESUMO

Líquen plano (LP) é uma doença mucocutânea de natureza inflamatória crônica de etiologia ainda desconhecida. Alterações na resposta imune inata, como aos padrões moleculares associados à patógenos (PAMPs) e padrões moleculares associados ao dano (DAMPs) podem levar à inflamação crônica e contribuir com a patogênese do LP. OBJETIVO: Avaliar o efeito da ativação via o DAMP S100A8 e o receptor Toll-like 4 (TLR-4) em células Natural killer (NK) e TCD8 citotóxicas e suas subpopulações de memória/efetoras em pacientes com LP. MÉTODOS: Foram selecionados 25 pacientes com LP (22 mulheres, 3 homens) com idade média de 43,46 anos ± 8,46 e um grupo controle com 25 indivíduos (22 mulheres, 3 homens) com idade média de 42 anos ± 5,5. A determinação transcricional e da expressão por imunohistoquimica dos DAMPs S100A8, HMGB-1 e de TLR-4 e RAGE foi realizada em biópsias de lesões cutâneas de indivíduos com LP, e os níveis séricos de S100A8, HMGB-1, MICA e MICB foram determinados por ELISA. As células mononucleares (CMNs) de sangue periférico foram avaliadas por citometria de fluxo quanto a frequência de TNF, IL-1beta e o marcador de desgranulação CD107a em células TCD8+ e células NK CD56+ e suas subpopulações. A avaliação da via de sinalização de TLR em células TCD8+ purificadas e ativadas com S100A8 foi analisada por PCR array e a determinação da expressão de mRNA dos componentes do inflamassoma em células TCD8+ ativadas com S100A8 por PCR em tempo real. RESULTADOS: Foi evidenciado nos indivíduos com LP elevada expressão da proteína S100A8 nas lesões cutâneas e de HMGB-1, TLR-4 e RAGE na derme, em paralelo ao aumento da expressão de mRNAs para S100A8 e S100A9 e diminuição de RAGE. Além disto, uma elevação dos níveis séricos do dímero S100A8/A9 foi detectada nos pacientes comparados aos controles, ao contrário do DAMP HMGB-1 que mostrou níveis similares em ambos os grupos. A influência do S100A8 em células TCD8+ e células NK, foi analisada em CMNs pela ativação...


Lichen planus (LP) is a mucocutaneous inflammatory chronic disease of unknown etiology. Alterations in the innate immune response such as the pathogen-associated molecular pattern (PAMPs) and damage-associated molecular pattern (DAMPs) can lead to chronic inflammation and contribute to the pathogenesis of LP. OBJECTIVE: Evaluate the effect of the activation trough the DAMP S100A8 and the Toll-like receptor 4 (TLR-4) on the Natural killer cells (NK) and cytotoxic TCD8 cells and their memory / effector subsets in LP disease. METHODS: We selected 25 patients with LP (22 women, 3 men) with a mean age of 43.46 years ± 8.46 and a control group of 25 subjects (22 women, 3 men) with a mean age of 42 ± 5, 5. The transcriptional determination and protein expression by immunohistochemistry of DAMPs, S100A8 and HMGB-1 as well as TLR-4 and RAGE was performed on biopsies of skin lesions from patients with LP, and serum levels of S100A8, HMGB-1, MICA and MICB were determined by ELISA. Peripheral blood mononuclear cells (PBMCs) were assessed by flow cytometry to evaluate the frequency of TNF, IL-1beta and the degranulation marker CD107a in CD8+ T cells and CD56 + NK cells and their subsets. The evaluation of the TLR signaling pathway in purified CD8 + T cells activated with S100A8 were analyzed by PCR array and the determination of mRNA expression of inflammasome components on CD8 + T cells activated by S100A8 was measured by real time PCR. RESULTS: It was shown in the LP individuals an increased expression of the S100A8 protein in the cutaneous lesions and HMGB-1, TLR-4 and RAGE in the dermis, in parallel to increased level of mRNAs for S100A8 and S100A9 and decreased expression of RAGE. Moerover, increased serum levels of the dimer S100A8 / A9 was detected in patients compared to controls, in contrast to DAMP HMGB1 that revealed similar levels in both groups. The influence of S100A8 in CD8 + T cells and NK cells, was analyzed in PBMC activating with...


Assuntos
Humanos , Masculino , Feminino , Peptídeos Catiônicos Antimicrobianos , Células Matadoras Induzidas por Citocinas , Citotoxicidade Imunológica , Líquen Plano
9.
J. venom. anim. toxins incl. trop. dis ; 22: 5, 2016. tab, graf, ilus
Artigo em Inglês | LILACS | ID: lil-773437

RESUMO

Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.(AU)


Assuntos
Animais , Peptídeos/isolamento & purificação , Análise de Sequência de DNA/métodos , Baratas/imunologia , Peptídeos Catiônicos Antimicrobianos/química , Sequência de Aminoácidos , Anti-Infecciosos/análise
10.
Rio de Janeiro; s.n; 2015. xiii,140 p. ilus, graf.
Tese em Inglês, Português | LILACS | ID: lil-774261

RESUMO

Rhodnius prolixus é um dos principais insetos vetores de Trypanosomacruzi e de Trypanosoma rangeli na América Latina. A produção de peptídeosantimicrobianos (AMPs) no trato digestivo ou corpo gorduroso do inseto é vitalpara evitar a proliferação de microrganismos patogênicos além de manter ahomeostasia da microbiota nativa. O presente trabalho focou na modulação daimunidade humoral do intestino médio de R. prolixus desafiados oralmente coma bactéria Gram-positiva Staphylococcus aureus e Gram-negativa Escherichiacoli, além de seus tripanosomatídeos naturais T. rangeli e T. cruzi, considerandoa influência do desenvolvimento dos parasitas sobre a microbiota intestinal. Emcondições normais, a região anterior do intestino médio houve maior abundânciade transcritos de genes de lisozimas (lis) e defensinas (def), enquanto naposterior, do gene da prolixicina (prol). Insetos alimentados com bactérias Gramnegativasapresentaram maior quantidade de transcritos de defC e prol,enquanto a ingestão de bactérias Gram-positivas induziu a expressão de defA edefB no intestino médio. A infecção por T. rangeli cepa Macias diminuiu aatividade fenoloxidásica, os níveis de expressão de lisozimas e prolixicina, aomesmo tempo em que induziu aumento de atividade antibacteriana e dos níveisde defensina C no tubo digestivo do inseto, também modificando a composiçãode bactérias nativas...


Rhodnius prolixus is a major vector of Trypanosoma rangeli andTrypanosoma cruzi, in Latin America. The production of antimicrobial peptides(AMPs) in the midgut of the insect is vital to control possible infection, and tomaintain the microbiota already present in the digestive tract. This work focuseson the modulation of the humoral immune responses of the midgut of R. prolixusorally challenged with Gram positive and Gram negative bacteria as well with T.rangeli Macias strain, T. cruzi Dm 28c and Y strain, considering the influence ofthe parasites on the intestinal microbiota. Our results showed that the anteriormidgut contents of control insects contain a higher inducible antibacterial activityand AMPs transcript abundance than those of the posterior midgut. Insects orallyfed with Gram-negative bacteria presented higher amount of defC and proltranscripts, while the ingestion of Gram-positive induced defA and defBexpression in the midgut. T. rangeli Macias strain successfully colonized R.prolixus midgut through a decreasing in PO activities, prolixicin and lysozymelevels, while at the same time induced an increase in antibacterial activity andupregulated defC levels in the insect anterior midgut. T. rangeli infection alsodiminishes the amount of cultivable gut bacteria as well modified the compositionof indigenous microorganisms. Furthermore, different T. cruzi strains presentdistinct profiles of immune system and microbiota modulation in R. prolixusmidgut, where T. cruzi Dm 28c was able to induce an increase in defensin Cgenes and a depression in prolixicin genes, while drastically reduce the cultivablebacteria population. In the other hand T. cruzi Y was not competent to induceAMPs expression in the gut or considerably reduce the microbiota in the anteriormidgut...


Assuntos
Animais , Peptídeos Catiônicos Antimicrobianos , Rhodnius/imunologia , Trypanosoma rangeli , Trypanosoma cruzi/imunologia , Fagocitose , Nodulação
11.
Araçatuba; s.n; 2015. 101 p. tab, graf.
Tese em Inglês | LILACS, BBO - Odontologia | ID: biblio-867453

RESUMO

A cárie precoce da infância (CPI) é ainda um grave problema de saúde pública no mundo, principalmente em países em desenvolvimento. Estudos têm sugerido a associação da ingestão frequente de carboidratos fermentáveis como a sacarose, altas contagens de microrganismos cariogênicos e maior vulnerabilidade imunológica da criança na etiologia da CPI. O objetivo deste estudo foi avaliar os aspectos microbiológicos e imunológicos associados ao desenvolvimento da cárie precoce da infância. Crianças com idade entre 36 e 60 meses foram selecionadas e divididas em três grupos: LC - livres de cárie, CPI e CPI-S (CPI-severa). Questionário sobre os aspectos socioeconômico-culturais, hábitos de higiene bucal e diários de dieta foram respondidos pelos responsáveis. Foram coletadas amostras de saliva e biofilme dental das crianças e processadas para subsequentes avaliações laboratoriais. Em seguida, os níveis de IgA salivar total e contra GbpB de S. mutans foram determinados por ELISA e Western blot, respectivamente, as concentrações salivares dos peptídeos catiônicos antimicrobianos (PCAM): defensinas hBD-2 e hBD-3, catelicidina LL-37 e histatina 5 (HTN-5) por ELISA e a presença e os níveis salivares de Streptococcus mutans, Streptococcus sobrinus, Lactobacillus spp., Bifidobacterium spp. e Scardovia wiggsiae por qRT-PCR, sendo que estes dados foram correlacionados com os níveis salivares e no biofilme dental de estreptococos mutans (SM) e Lactobacillus spp. por meio de cultivo em meios específicos. Os resultados mostraram que as crianças com CPI-S apresentaram menor renda familiar quando comparadas às crianças LC ou CPI. Contudo, a ingestão de açúcar não diferiu entre os grupos. O grupo CPI-S apresentou maior contagem de SM na saliva/biofilme em relação aos grupos LC e CPI. Houve uma correlação positiva entre a resposta de IgA contra GbpB e os níveis de SM, quando a população geral foi avaliada. Quando apenas crianças com altos níveis de SM foram comparadas, o grupo CPI-S...


Early childhood caries (ECC) is still a serious public health problem worldwide, especially in developing countries. Studies have been suggested the association among frequent intake of fermentable carbohydrates such as sucrose, high cariogenic microorganism’s counts and child’s immune vulnerability in the etiology of ECC. The objective of this study was to evaluate the microbiological and immunological factors for the development of early childhood caries. 36 to 60 monthold children were selected and distributed into three groups: caries free (CF), ECC and S-ECC (severe-ECC). Questionnaires about socio-economic-cultural data, oral hygiene habits and food-frequency diary were completed by the parents. Saliva and dental biofilm were collected from children and processed for subsequent laboratorial tests. The following analyses were determined: total IgA and IgA response against S. mutans GbpB by ELISA and Western blot, respectively; salivary concentrations of antimicrobial peptides (AMPs): defensins hBD-2 and hBD-3, cathelicidin LL-37 and histatin 5 (HTN-5) by ELISA; salivary detection and quantification of Streptococcus mutans, Streptococcus sobrinus, Lactobacillus spp., Bifidobacterium spp. and Scardovia wiggsiae by qRT-PCR, and these data were correlated with mutans streptococci (MS) and Lactobacillus spp. levels by culture in specific medium. Results showed that S-ECC children had reduced family income compared to ECC and CF. However, sugar intake did not differ among the groups. S-ECC group had higher MS count than CF/ECC groups. Positive correlations between salivary IgA response against GbpB and MS counts were found when the entire population was evaluated. When children with high mutans streptococci counts were compared, S-ECC group showed a significant decrease in IgA antibody levels against GbpB compared to CF group. This finding was not observed for ECC group. The present study showed positive correlations between salivary hBD-2 and HTN-5 with…


Assuntos
Humanos , Masculino , Feminino , Pré-Escolar , Peptídeos Catiônicos Antimicrobianos , Bactérias , Cárie Dentária , Sistema Imunitário , Saúde Pública , Defensinas , Imunidade Inata , Lactobacillus , Streptococcus mutans
12.
Araçatuba; s.n; 2015. 101 p. tab, graf.
Tese em Português | LILACS, BBO - Odontologia | ID: biblio-870075

RESUMO

A cárie precoce da infância (CPI) é ainda um grave problema de saúde pública no mundo, principalmente em países em desenvolvimento. Estudos têm sugerido a associação da ingestão frequente de carboidratos fermentáveis como a sacarose, altas contagens de microrganismos cariogênicos e maior vulnerabilidade imunológica da criança na etiologia da CPI. O objetivo deste estudo foi avaliar os aspectos microbiológicos e imunológicos associados ao desenvolvimento da cárie precoce da infância. Crianças com idade entre 36 e 60 meses foram selecionadas e divididas em três grupos: LC - livres de cárie, CPI e CPI-S (CPI-severa). Questionário sobre os aspectos socioeconômico-culturais, hábitos de higiene bucal e diários de dieta foram respondidos pelos responsáveis. Foram coletadas amostras de saliva e biofilme dental das crianças e processadas para subsequentes avaliações laboratoriais. Em seguida, os níveis de IgA salivar total e contra GbpB de S. mutans foram determinados por ELISA e Western blot, respectivamente, as concentrações salivares dos peptídeos catiônicos antimicrobianos (PCAM): defensinas hBD-2 e hBD-3, catelicidina LL-37 e histatina 5 (HTN-5) por ELISA e a presença e os níveis salivares de Streptococcus mutans, Streptococcus sobrinus, Lactobacillus spp., Bifidobacterium spp. e Scardovia wiggsiae por qRT-PCR, sendo que estes dados foram correlacionados com os níveis salivares e no biofilme dental de estreptococos mutans (SM) e Lactobacillus spp. por meio de cultivo em meios específicos. Os resultados mostraram que as crianças com CPI-S apresentaram menor renda familiar quando comparadas às crianças LC ou CPI. Contudo, a ingestão de açúcar não diferiu entre os grupos. O grupo CPI-S apresentou maior contagem de SM na saliva/biofilme em relação aos grupos LC e CPI. Houve uma correlação positiva entre a resposta de IgA contra GbpB e os níveis de SM, quando a população geral foi avaliada. Quando apenas crianças com altos níveis de SM foram comparadas, o grupo CPI-S...


Early childhood caries (ECC) is still a serious public health problem worldwide, especially in developing countries. Studies have been suggested the association among frequent intake of fermentable carbohydrates such as sucrose, high cariogenic microorganism’s counts and child’s immune vulnerability in the etiology of ECC. The objective of this study was to evaluate the microbiological and immunological factors for the development of early childhood caries. 36 to 60 monthold children were selected and distributed into three groups: caries free (CF), ECC and S-ECC (severe-ECC). Questionnaires about socio-economic-cultural data, oral hygiene habits and food-frequency diary were completed by the parents. Saliva and dental biofilm were collected from children and processed for subsequent laboratorial tests. The following analyses were determined: total IgA and IgA response against S. mutans GbpB by ELISA and Western blot, respectively; salivary concentrations of antimicrobial peptides (AMPs): defensins hBD-2 and hBD-3, cathelicidin LL-37 and histatin 5 (HTN-5) by ELISA; salivary detection and quantification of Streptococcus mutans, Streptococcus sobrinus, Lactobacillus spp., Bifidobacterium spp. and Scardovia wiggsiae by qRT-PCR, and these data were correlated with mutans streptococci (MS) and Lactobacillus spp. levels by culture in specific medium. Results showed that S-ECC children had reduced family income compared to ECC and CF. However, sugar intake did not differ among the groups. S-ECC group had higher MS count than CF/ECC groups. Positive correlations between salivary IgA response against GbpB and MS counts were found when the entire population was evaluated. When children with high mutans streptococci counts were compared, S-ECC group showed a significant decrease in IgA antibody levels against GbpB compared to CF group. This finding was not observed for ECC group. The present study showed positive correlations between salivary hBD-2 and HTN-5 with…


Assuntos
Humanos , Masculino , Feminino , Pré-Escolar , Peptídeos Catiônicos Antimicrobianos , Bactérias , Cárie Dentária , Sistema Imunitário , Saúde Pública , Defensinas , Imunidade Inata , Lactobacillus , Streptococcus mutans
13.
Braz. j. microbiol ; 45(3): 1089-1094, July-Sept. 2014. ilus, tab
Artigo em Inglês | LILACS | ID: lil-727042

RESUMO

P34 is an antimicrobial peptide produced by a Bacillus sp. strain isolated from the intestinal contents of a fish in the Brazilian Amazon basin with reported antibacterial activity. The aim of this work was to evaluate the peptide P34 for its in vitro antiviral properties against canine adenovirus type 2 (CAV-2), canine coronavirus (CCoV), canine distemper virus (CDV), canine parvovirus type 2 (CPV-2), equine arteritis virus (EAV), equine influenza virus (EIV), feline calicivirus (FCV) and feline herpesvirus type 1 (FHV-1). The results showed that the peptide P34 exhibited antiviral activity against EAV and FHV-1. The peptide P34 inhibited the replication of EAV by 99.9% and FHV-1 by 94.4%. Virucidal activity was detected only against EAV. When P34 and EAV were incubated for 6 h at 37 °C the viral titer reduced from 10(4.5) TCID50 to 10(2.75) TCID50, showing a percent of inhibition of 98.6%. In conclusion, our results demonstrated that P34 inhibited EAV and FHV-1 replication in infected cell cultures and it showed virucidal activity against EAV. Since there is documented resistance to the current drugs used against herpesviruses and there is no treatment for equine viral arteritis, it is advisable to search for new antiviral compounds to overcome these infections.


Assuntos
Animais , Animais Domésticos/virologia , Peptídeos Catiônicos Antimicrobianos/farmacologia , Antivirais/farmacologia , Bacillus/metabolismo , Vírus/efeitos dos fármacos , Peptídeos Catiônicos Antimicrobianos/isolamento & purificação , Antivirais/isolamento & purificação , Brasil , Bacillus/isolamento & purificação , Proteínas de Bactérias/isolamento & purificação , Proteínas de Bactérias/farmacologia , Peixes/microbiologia , Trato Gastrointestinal/microbiologia , Viabilidade Microbiana/efeitos dos fármacos , Temperatura , Fatores de Tempo , Carga Viral , Replicação Viral/efeitos dos fármacos
14.
Braz. j. microbiol ; 44(4): 1291-1298, Oct.-Dec. 2013. ilus, tab
Artigo em Inglês | LILACS | ID: lil-705286

RESUMO

The amidated analog of Plantaricin149, an antimicrobial peptide from Lactobacillus plantarum NRIC 149, directly interacts with negatively charged liposomes and bacterial membranes, leading to their lysis. In this study, four Pln149-analogs were synthesized with different hydrophobic groups at their N-terminus with the goal of evaluating the effect of the modifications at this region in the peptide's antimicrobial properties. The interaction of these peptides with membrane models, surface activity, their hemolytic effect on red blood cells, and antibacterial activity against microorganisms were evaluated. The analogs presented similar action of Plantaricin149a; three of them with no hemolytic effect (< 5%) until 0.5 mM, in addition to the induction of a helical element when binding to negative liposomes. The N-terminus difference between the analogs and Plantaricin149a retained the antibacterial effect on S. aureus and P. aeruginosa for all peptides (MIC50 of 19 µM and 155 µM to Plantaricin149a, respectively) but resulted in a different mechanism of action against the microorganisms, that was bactericidal for Plantaricin149a and bacteriostatic for the analogs. This difference was confirmed by a reduction in leakage action for the analogs. The lytic activity of Plantaricin149a is suggested to be a result of the peptide-lipid interactions from the amphipathic helix and the hydrophobic residues at the N-terminus of the antimicrobial peptide.


Assuntos
Peptídeos Catiônicos Antimicrobianos/metabolismo , Bactérias/efeitos dos fármacos , Bacteriocinas/metabolismo , Membrana Celular/efeitos dos fármacos , Bicamadas Lipídicas/metabolismo , Peptídeos Catiônicos Antimicrobianos/genética , Bacteriocinas/genética , Lactobacillus plantarum/metabolismo , Testes de Sensibilidade Microbiana , Pseudomonas aeruginosa/efeitos dos fármacos , Staphylococcus aureus/efeitos dos fármacos
15.
Braz. j. allergy immunol ; 1(5): 261-266, sept.-out. 2013.
Artigo em Português | LILACS | ID: lil-775973

RESUMO

Não há consenso sobre quais são os valores ideais da vitamina D em crianças saudáveis. Porém, níveis séricos altos ou baixos parecem ter influência na fisiopatologia das doenças alérgicas. Há dados na literatura atual que demonstram os potenciais efeitos da vitamina D em aumentar a atividade dos peptídeos antimicrobianos e suprimir a resposta inflamatória, apontando uma relação inversa entre os níveis de vitamina D e a gravidade da dermatite atópica. O objetivo do presente trabalho foi revisar artigos publicados sobre a relação entre níveis séricos de vitamina D e dermatite atópica, uma vez que a vitamina D tem sido implicada em várias ações imunomoduladoras e alguns estudos têm descrito sua influência na gravidade da dermatite atópica, porém com resultados conflitantes. Este estudo baseou-se em revisão de artigos originais, artigos de revisão e consensos publicados nos últimos 10 anos, obtidos a partir da pesquisa dos termos “vitamin D” e “atopic dermatitis”, nos bancos de dados online. Concluímos que a suplementação da vitamina D pode trazer benefícios no tratamento da dermatite atópica. No entanto, mais pesquisas são necessárias para determinar se existe alguma relação entre os níveis de vitamina D e a gravidade da dermatite atópica.


There is no consensus about optimal values of vitamin D in normal children. However, high or low serum levels seem to influence the pathophysiology of allergic diseases. There is evidence supporting the potential effects of vitamin D on increasing the activity of antimicrobial peptides and suppressing the inflammatory response, indicating an inverse relationship between vitamin D levels and the severity of atopic dermatitis. Our objective was to review published articles on the relationship between serum vitamin D levels and atopic dermatitis, as vitamin D has been implicated in several immunoregulatory actions, and some studies have reported an influence on the severity of atopic dermatitis, with conflicting results. The present study reviewed original articles, review articles, and consensus documents published in the past 10 years, retrieved in online databases using the keywords “vitamin D” and “atopic dermatitis.” We conclude that vitamin D supplementation may be beneficial in the treatment of atopic dermatitis. However, more research is needed to determine whether there is any relationship between vitamin D levels and atopic dermatitis severity.


Assuntos
Humanos , Peptídeos Catiônicos Antimicrobianos , Dermatite Atópica , Fatores Imunológicos , Deficiência de Vitamina D , Técnicas e Procedimentos Diagnósticos , Inflamação , Métodos
16.
Rev. bras. plantas med ; 15(2): 180-187, 2013. graf
Artigo em Português | LILACS | ID: lil-677024

RESUMO

Extratos aquosos da planta medicinal Achillea millefolium contêm macromoléculas de interesse para desenvolver fitodefensivos para a agricultura. Duas frações de mil folhas foram obtidas por ultrafiltração, E1 (contendo moléculas maiores que 30 kDa), e E3 (peptídeos entre 1 e 10 kDa) que inibiram o crescimento das bactérias fitopatogênicas Ralstonia solanacearum, gram-negativa, e Clavibacter michiganensis subsp. michiganensis, gram-positiva, com dependência de concentração. Os valores de concentração inibitória mínima (CIM) para ambos os extratos e bactérias foram baixos, entre 20 e 80µM. A CIM relativa à proteína total evidenciou a presença de macromoléculas muito ativas em E3, embora com baixa concentração proteica. E3 se aplica à prospecção de peptídeos antimicrobianos. Estimar a CIM relativa à quantidade de amostra vegetal valorizou o potencial antimicrobiano natural de E1, que contém alta concentração proteica. E1e E3 se aplicam ao desenvolvimento de fitodefensivos para uso biotecnológico. A ultrafiltração fracionou as amostras de forma nativa, rápida, e com baixo custo; além de dessalinizar, clarificar, purificar, e concentrar E1 e E3. Esse estudo inédito sobre a separômica e a ação antimicrobiana de extratos macromoleculares aquosos de mil folhas sugere que plantas cicatrizantes podem apresentar grande potencial para desenvolver fitodefensivos agrícolas naturais não danosos, à semelhança de medicamentos fitoterápicos.


Aqueous extracts from the medicinal plant Achillea millefolium contain macromolecules of interest to develop agrochemicals for agriculture. Two fractions of "mil folhas" were obtained by ultrafiltration, E1 (containing molecules larger than 30 kDa) and E3 (peptides between 1 and 10 kDa), which inhibited the growth of phytopathogenic bacteria Ralstonia solanacearum, gram-negative, and Clavibacter michiganensis subsp. michiganensis, gram-positive, concentration-dependent. The values of minimum inhibitory concentration (MIC) for both extracts and both bacteria were low, ranging from 20 to 80µM. The MIC relative to total protein evidenced the presence of very active macromolecules in E3, although showing low protein concentration. E3 applies to the prospection of antimicrobial peptides. The estimated MIC relative to the amount of plant sample valued the natural antimicrobial potential of E1, which contains high protein concentration. E1 and E3 can be used in the development of agrochemicals for biotechnological purposes. The ultrafiltration procedure fractionated the samples in a rapid and native way and at a low cost; it also desalted, clarified, concentrated and purified both E1 and E3. This pioneering study on the separomics and on the antimicrobial activity of macromolecular aqueous extracts from "mil folhas" suggests that healing plants have great potential to develop non-harmful agricultural natural agrochemicals, similarly to the available phytotherapic drugs.


Assuntos
Achillea/efeitos adversos , Agroquímicos/administração & dosagem , Plantas Medicinais/classificação , Peptídeos Catiônicos Antimicrobianos , Testes de Sensibilidade Microbiana/métodos , Extratos Vegetais/efeitos adversos , Ralstonia solanacearum
17.
Mem. Inst. Oswaldo Cruz ; 107(supl.1): 183-189, Dec. 2012. ilus
Artigo em Inglês | LILACS, Sec. Est. Saúde SP, HANSEN, SESSP-ILSLPROD, Sec. Est. Saúde SP, SESSP-ILSLACERVO, Sec. Est. Saúde SP | ID: lil-659757

RESUMO

Iron is essential for all organisms and its availability can control the growth of microorganisms; therefore, we examined the role of iron metabolism in multibacillary (MB) leprosy, focusing on the involvement of hepcidin. Erythrograms, iron metabolism parameters, pro-inflammatory cytokines and urinary hepcidin levels were evaluated in patients with MB and matched control subjects. Hepcidin expression in MB lesions was evaluated by quantitative polymerase chain reaction. The expression of ferroportin and hepcidin was evaluated by immunofluorescence in paucibacillary and MB lesions. Analysis of hepcidin protein levels in urine and of hepcidin mRNA and protein levels in leprosy lesions and skin biopsies from healthy control subjects showed elevated hepcidin levels in MB patients. Decreases in haematologic parameters and total iron binding capacity were observed in patients with MB leprosy. Moreover, interleukin-1 beta, ferritin, soluble transferrin receptor and soluble transferrin receptor/log ferritin index values were increased in leprosy patients. Hepcidin was elevated in lepromatous lesions, whereas ferroportin was more abundant in tuberculoid lesions. In addition, hepcidin and ferroportin were not colocalised in the biopsies from leprosy lesions. Anaemia was not commonly observed in patients with MB; however, the observed changes in haematologic parameters indicating altered iron metabolism appeared to result from a mixture of anaemia of inflammation and iron deficiency. Thus, iron sequestration inside host cells might play a role in leprosy by providing an optimal environment for the bacillus.


Assuntos
Humanos , Peptídeos Catiônicos Antimicrobianos/urina , Citocinas/sangue , Ferro/metabolismo , Hanseníase Multibacilar/sangue , Hanseníase Multibacilar/urina , Anemia/microbiologia , Estudos de Casos e Controles , Progressão da Doença , Imunofluorescência , Homeopatia , Inflamação/microbiologia , Hanseníase Multibacilar/complicações , Reação em Cadeia da Polimerase
18.
Braz. j. med. biol. res ; 45(11): 1017-1024, Nov. 2012. ilus, tab
Artigo em Inglês | LILACS | ID: lil-650575

RESUMO

Neutrophils play an important role in periodontitis by producing nitric oxide (NO) and antimicrobial peptides, molecules with microbicidal activity via oxygen-dependent and -independent mechanisms, respectively. It is unknown whether variation in the production of antimicrobial peptides such as LL-37, human neutrophil peptides (HNP) 1-3, and NO by neutrophils influences the pathogenesis of periodontal diseases. We compared the production of these peptides and NO by lipopolysaccharide (LPS)-stimulated neutrophils isolated from healthy subjects and from patients with periodontitis. Peripheral blood neutrophils were cultured with or without Aggregatibacter actinomycetemcomitans-LPS (Aa-LPS), Porphyromonas gingivalis-LPS (Pg-LPS) and Escherichia coli-LPS (Ec-LPS). qRT-PCR was used to determine quantities of HNP 1-3 and LL-37 mRNA in neutrophils. Amounts of HNP 1-3 and LL-37 proteins in the cell culture supernatants were also determined by ELISA. In addition, NO levels in neutrophil culture supernatants were quantitated by the Griess reaction. Neutrophils from periodontitis patients cultured with Aa-LPS, Pg-LPS and Ec-LPS expressed higher HNP 1-3 mRNA than neutrophils from healthy subjects. LL-37 mRNA expression was higher in neutrophils from patients stimulated with Aa-LPS. Neutrophils from periodontitis patients produced significantly higher LL-37 protein levels than neutrophils from healthy subjects when stimulated with Pg-LPS and Ec-LPS, but no difference was observed in HNP 1-3 production. Neutrophils from periodontitis patients cultured or not with Pg-LPS and Ec-LPS produced significantly lower NO levels than neutrophils from healthy subjects. The significant differences in the production of LL-37 and NO between neutrophils from healthy and periodontitis subjects indicate that production of these molecules might influence individual susceptibility to important periodontal pathogens.


Assuntos
Adulto , Feminino , Humanos , Masculino , Pessoa de Meia-Idade , Peptídeos Catiônicos Antimicrobianos/biossíntese , Neutrófilos/metabolismo , Óxido Nítrico/biossíntese , Periodontite/imunologia , alfa-Defensinas/biossíntese , Estudos de Casos e Controles , Doença Crônica , Índice de Placa Dentária , Ensaio de Imunoadsorção Enzimática , Citometria de Fluxo , Lipopolissacarídeos , Neutrófilos/imunologia , Índice Periodontal , Periodontite/metabolismo , Reação em Cadeia da Polimerase Via Transcriptase Reversa
19.
Electron. j. biotechnol ; 15(2): 3-3, Mar. 2012. ilus, tab
Artigo em Inglês | LILACS | ID: lil-640538

RESUMO

Different strategies have been used to overcome the difficulties to produce antimicrobial peptides. Here we used Intein Mediated Purification with an Affinity Chitin-binding Tag (IMPACT-System, New England Biolabs) for the expression of the antimicrobial peptide cecropin to reduce its sensitivity to intracellular proteases and use its inducible self-cleaving capability to remove the carrier. Cecropin was cloned into suitable expression vector pTYB11, and expression induced by IPTG in Escherichia coli ER2566. The use of 22ºC induction allowed the expression of cecropin with its intein carrier in soluble form. Cell extracts were purified by chitin affinity chromatography and intein-mediated splicing of the target protein was achieved by thiol addition, obtaining a final yield of 2.5 mg cecropin/l. Cecropin cleaved from the intein had its proper biologically active form, showing a micromolar antimicrobial activity against Vibrio ordalii, Vibrio alginolyticus and Escherichia coli.


Assuntos
Humanos , Antibacterianos/metabolismo , Cecropinas/metabolismo , Escherichia coli , Western Blotting , Cromatografia de Afinidade , Cromatografia Líquida de Alta Pressão , Clonagem Molecular , Fusão Gênica , Inteínas , Peptídeos Catiônicos Antimicrobianos/metabolismo , Proteínas Recombinantes
20.
Invest. clín ; 53(1): 71-83, mar. 2012. ilus, tab
Artigo em Espanhol | LILACS | ID: lil-664567

RESUMO

La infección por VIH (virus de la inmunodeficiencia humana) en la actualidad es un grave problema de salud pública a nivel mundial, que requiere de nuevas estrategias vacunales para detener su propagación así como para su efectivo tratamiento. Algunos estudios relacionados con la inmunidad innata en contra de VIH, han demostrado que los péptidos antimicrobianos (AMP´s) pueden generar resistencia a las infecciones virales. En la presente revisión, se describen a los péptidos antimicrobianos de humano y su actividad en contra de VIH así como péptidos de otras especies como plantas, anfibios, insectos y varias especies de animales que poseen un potencial terapéutico o profiláctico en la infección por VIH. Se describen brevemente algunos mecanismos mediante los cuales estos péptidos pueden bloquear la replicación e infección por el VIH.


HIV (human immunodeficiency virus) infection is today a very important health issue worldwide, which demands new ways and strategies for its prevention and treatment. Several studies on the innate immunity against HIV infection have shown that antimicrobial peptides are associated with increased resistance to infection. In the present review, we briefly summarize the major characteristics of antimicrobial peptides from human and several species of plants, amphibians, insects and other animal species that have significant potential to be used as therapeutic or prophylactic agents. The mechanisms of infection inhibition and viral replication blockade are also described in the context of the biology of infection.


Assuntos
Animais , Humanos , Fármacos Anti-HIV/uso terapêutico , Peptídeos Catiônicos Antimicrobianos/uso terapêutico , Infecções por HIV/tratamento farmacológico , Fármacos Anti-HIV/isolamento & purificação , Fármacos Anti-HIV/farmacologia , Peptídeos Catiônicos Antimicrobianos/isolamento & purificação , Peptídeos Catiônicos Antimicrobianos/farmacologia , Descoberta de Drogas , Avaliação Pré-Clínica de Medicamentos , HIV , Invertebrados/química , Plantas/química , Especificidade da Espécie , Vertebrados/metabolismo , Replicação Viral/efeitos dos fármacos
SELEÇÃO DE REFERÊNCIAS
DETALHE DA PESQUISA