Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 45
Filtrar
Más filtros











Base de datos
Intervalo de año de publicación
1.
Front Med (Lausanne) ; 10: 1228833, 2023.
Artículo en Inglés | MEDLINE | ID: mdl-37671403

RESUMEN

Background and objective: Accurate and fast diagnosis of rheumatic diseases affecting the hands is essential for further treatment decisions. Fluorescence optical imaging (FOI) visualizes inflammation-induced impaired microcirculation by increasing signal intensity, resulting in different image features. This analysis aimed to find specific image features in FOI that might be important for accurately diagnosing different rheumatic diseases. Patients and methods: FOI images of the hands of patients with different types of rheumatic diseases, such as rheumatoid arthritis (RA), osteoarthritis (OA), and connective tissue diseases (CTD), were assessed in a reading of 20 different image features in three phases of the contrast agent dynamics, yielding 60 different features for each patient. The readings were analyzed for mutual differential diagnosis of the three diseases (One-vs-One) and each disease in all data (One-vs-Rest). In the first step, statistical tools and machine-learning-based methods were applied to reveal the importance rankings of the features, that is, to find features that contribute most to the model-based classification. In the second step machine learning with a stepwise increasing number of features was applied, sequentially adding at each step the most crucial remaining feature to extract a minimized subset that yields the highest diagnostic accuracy. Results: In total, n = 605 FOI of both hands were analyzed (n = 235 with RA, n = 229 with OA, and n = 141 with CTD). All classification problems showed maximum accuracy with a reduced set of image features. For RA-vs.-OA, five features were needed for high accuracy. For RA-vs.-CTD ten, OA-vs.-CTD sixteen, RA-vs.-Rest five, OA-vs.-Rest eleven, and CTD-vs-Rest fifteen, features were needed, respectively. For all problems, the final importance ranking of the features with respect to the contrast agent dynamics was determined. Conclusions: With the presented investigations, the set of features in FOI examinations relevant to the differential diagnosis of the selected rheumatic diseases could be remarkably reduced, providing helpful information for the physician.

2.
Sci Rep ; 13(1): 1321, 2023 01 24.
Artículo en Inglés | MEDLINE | ID: mdl-36693888

RESUMEN

Ratiometric green-red fluorescent nanosensors for fluorometrically monitoring pH in the acidic range were designed from 80 nm-sized polystyrene (PS) and silica (SiO2) nanoparticles (NPs), red emissive reference dyes, and a green emissive naphthalimide pH probe, analytically and spectroscopically characterized, and compared regarding their sensing performance in aqueous dispersion and in cellular uptake studies. Preparation of these optical probes, which are excitable by 405 nm laser or LED light sources, involved the encapsulation of the pH-inert red-fluorescent dye Nile Red (NR) in the core of self-made carboxylated PSNPs by a simple swelling procedure and the fabrication of rhodamine B (RhB)-stained SiO2-NPs from a silane derivative of pH-insensitive RhB. Subsequently, the custom-made naphthalimide pH probe, that utilizes a protonation-controlled photoinduced electron transfer process, was covalently attached to the carboxylic acid groups at the surface of both types of NPs. Fluorescence microscopy studies with the molecular and nanoscale optical probes and A549 lung cancer cells confirmed the cellular uptake of all probes and their penetration into acidic cell compartments, i.e., the lysosomes, indicated by the switching ON of the green naphthalimide fluorescence. This underlines their suitability for intracellular pH sensing, with the SiO2-based nanosensor revealing the best performance regarding uptake speed and stability.


Asunto(s)
Nanopartículas , Dióxido de Silicio , Dióxido de Silicio/química , Poliestirenos , Naftalimidas , Colorantes Fluorescentes/química , Nanopartículas/química , Concentración de Iones de Hidrógeno
3.
Diagnostics (Basel) ; 12(8)2022 Jul 22.
Artículo en Inglés | MEDLINE | ID: mdl-35892489

RESUMEN

Rheumatologists in Europe and the USA increasingly rely on fluorescence optical imaging (FOI, Xiralite) for the diagnosis of inflammatory diseases. Those include rheumatoid arthritis, psoriatic arthritis, and osteoarthritis, among others. Indocyanine green (ICG)-based FOI allows visualization of impaired microcirculation caused by inflammation in both hands in one examination. Thousands of patients are now documented and most literature focuses on inflammatory arthritides, which affect synovial joints and their related structures, making it a powerful tool in the diagnostic process of early undifferentiated arthritis and rheumatoid arthritis. However, it has become gradually clear that this technique has the potential to go even further than that. FOI allows visualization of other types of tissues. This means that FOI can also support the diagnostic process of vasculopathies, myositis, collagenoses, and other connective tissue diseases. This work summarizes the most prominent imaging features found in FOI examinations of inflammatory diseases, outlines the underlying anatomical structures, and introduces a nomenclature for the features and, thus, supports the idea that this tool is a useful part of the imaging repertoire in rheumatology clinical practice, particularly where other imaging methods are not easily available.

4.
Anal Chem ; 94(27): 9656-9664, 2022 07 12.
Artículo en Inglés | MEDLINE | ID: mdl-35731967

RESUMEN

A first tricolor fluorescent pH nanosensor is presented, which was rationally designed from biocompatible carboxylated polystyrene nanoparticles and two analyte-responsive molecular fluorophores. Its fabrication involved particle staining with a blue-red-emissive dyad, consisting of a rhodamine moiety responsive to acidic pH values and a pH-inert quinoline fluorophore, followed by the covalent attachment of a fluorescein dye to the particle surface that signals neutral and basic pH values with a green fluorescence. These sensor particles change their fluorescence from blue to red and green, depending on the pH and excitation wavelength, and enable ratiometric pH measurements in the pH range of 3.0-9.0. The localization of the different sensor dyes in the particle core and at the particle surface was confirmed with fluorescence microscopy utilizing analogously prepared polystyrene microparticles. To show the application potential of these polystyrene-based multicolor sensor particles, fluorescence microscopy studies with a human A549 cell line were performed, which revealed the cellular uptake of the pH nanosensor and the differently colored emissions in different cell organelles, that is, compartments of the endosomal-lysosomal pathway. Our results demonstrate the underexplored potential of biocompatible polystyrene particles for multicolor and multianalyte sensing and bioimaging utilizing hydrophobic and/or hydrophilic stimuli-responsive luminophores.


Asunto(s)
Colorantes Fluorescentes , Poliestirenos , Fluoresceína/química , Colorantes Fluorescentes/química , Humanos , Concentración de Iones de Hidrógeno , Rodaminas/química
5.
J Mater Chem B ; 5(24): 4754-4767, 2017 Jun 28.
Artículo en Inglés | MEDLINE | ID: mdl-32264318

RESUMEN

The destruction of articular cartilage is a critical feature in joint diseases. An approach to selectively target the damaged tissue is promising for the development of diagnostic and therapeutic agents. We herein present the interaction of dendritic polyglycerol (dPG) anions with native and inflamed cartilage. Confocal laser scanning microscopy revealed the inert character of dPG and low functionalized dPG bisphosphonate (dPGBP7%) toward cartilage in vitro. An enhanced binding was observed for highly functionalized dPG bisphosphonate, sulfate, and phosphate, which additionally showed a higher affinity to IL-1ß treated tissue. The mixed anion containing sulfate and bisphosphonate groups exhibited an exceptionally high affinity to cartilage and strongly bound to collagen type II, as shown by a normalized fluorescence-based binding assay. All polyglycerol anions, except dPGBP7%, were taken up by chondrocytes within 24 h and no cytotoxicity was found up to 10-5 M. In a rheumatoid arthritis model, dPGBP7% accumulated in mineralized compartments of inflamed joints and showed an increasing affinity to cartilage with higher clinical scores, as evident from histological examinations. For dPGS no interaction with bone but a strong binding to cartilage, independent of the score, was demonstrated. These results make dPG anions promising candidates for the selective targeting of cartilage tissue.

6.
Invest Ophthalmol Vis Sci ; 57(2): 759-70, 2016 Feb.
Artículo en Inglés | MEDLINE | ID: mdl-26927569

RESUMEN

PURPOSE: Anti-VEGF therapy has improved functional outcome for many patients with neovascular AMD. A particular challenge in routine clinical application is to find the best treatment regimen as a high degree of interindividual variability of disease activity has been noted. The aim of the study was to investigate fluorescent probes linked to antibodies against VEGF for in vivo imaging in an animal model. METHODS: Bevacizumab, B20-4.1.1 and AF564 were covalently attached to the novel dye 6S-indocyanine green (ICG) maleimide. Binding and proliferation properties were assessed. In a rat model of laser-induced choroidal neovascularization, retinal uptake and topographic localization of antibody-conjugates were analyzed. Distribution and accumulation of the probes were determined by immunohistochemistry and flow cytometry analysis. RESULTS: Antibody-conjugates retained target binding affinity and showed no toxicity. In vivo imaging showed a strong fluorescence immediately following an intravenous or intravitreal injection. While accumulation within the laser lesions was visualized for all three antibody conjugates, the signal strength and the duration of fluorescence varied. In addition, distinct fluorescent spots were also recognized. Patterning and in-depth analyses including histology and flow cytometry data strongly suggest that the fluorescent spots represent labeled microglial cells and/or macrophages. CONCLUSIONS: Pharmacokinetics of fluorescent-labeled bevacizumab, B20-4.1.1 and AF564 can be investigated in vivo. In this model, interpretation of long-term in vivo observations is difficult because of a possible rat-specific immune response and challenges to image localized binding of soluble VEGF. Further investigations in a primate model and the use of appropriate antibodies directed against the VEGF-receptor may represent alternative approaches.


Asunto(s)
Bevacizumab/análisis , Colorantes Fluorescentes/análisis , Inmunoconjugados/análisis , Verde de Indocianina/análisis , Imagen Óptica/métodos , Factor A de Crecimiento Endotelial Vascular/inmunología , Animales , Bevacizumab/administración & dosificación , Bevacizumab/química , Bevacizumab/farmacocinética , Neovascularización Coroidal/metabolismo , Modelos Animales de Enfermedad , Citometría de Flujo/métodos , Colorantes Fluorescentes/administración & dosificación , Colorantes Fluorescentes/farmacocinética , Humanos , Inmunoconjugados/administración & dosificación , Inmunoconjugados/inmunología , Inmunoconjugados/farmacocinética , Inmunohistoquímica/métodos , Verde de Indocianina/administración & dosificación , Verde de Indocianina/química , Verde de Indocianina/farmacocinética , Inyecciones Intravítreas , Rayos Láser , Fotocoagulación/métodos , Masculino , Ratas , Resultado del Tratamiento
7.
Ann Hematol ; 95(3): 465-72, 2016 Feb.
Artículo en Inglés | MEDLINE | ID: mdl-26634847

RESUMEN

Graft-versus-host disease (GvHD) is a severe immune reaction commonly occurring after hematopoietic stem cell transplantation. The outcome of patients who do not respond to the currently used immunosuppressive drugs is poor, thus there is an urgent need for the evaluation of new therapies. Heparin has a well-known anti-inflammatory effect and heparin analogues with a low anticoagulant effect are interesting candidates as new anti-inflammatory drugs. We explored the therapeutic potential of dendritic polyglycerol sulfates (dPGS), a novel class of heparin derivatives, on murine acute GvHD in vivo. The therapeutic effect of dPGS on murine GvHD was more intense after intravenous application compared to subcutaneous injection. An increased survival rate and improved clinical scores were observed in mice treated with 5 mg/kg once a week. In these animals, there was a reduction in the percentage of CD4(+) and CD8(+) T cells, which are the main effectors of GvHD. In addition, dPGS treatment decreased the number of tumor necrosis factor alpha (TNFα)-producing T cells. Increasing the dose of dPGS reversed the positive effect on survival as well as the clinical score, which indicates a small therapeutic range. Here, we report for the first time that dPGS have a significant immunosuppressive in vivo effect in a mouse model of severe acute GvHD. Therefore, we propose to study dPGS as promising candidates for the development of potential new drugs in the treatment of steroid-refractory GvHD patients first in larger animals and later in humans.


Asunto(s)
Dendrímeros/uso terapéutico , Glicerol/uso terapéutico , Enfermedad Injerto contra Huésped/prevención & control , Polímeros/uso terapéutico , Sulfatos/uso terapéutico , Animales , Trasplante de Médula Ósea/efectos adversos , Enfermedad Injerto contra Huésped/etiología , Enfermedad Injerto contra Huésped/patología , Masculino , Ratones , Ratones Endogámicos BALB C , Ratones Endogámicos C57BL
8.
BMC Musculoskelet Disord ; 16: 387, 2015 Dec 15.
Artículo en Inglés | MEDLINE | ID: mdl-26671580

RESUMEN

BACKGROUND: Anti-inflammatory nanoparticular compounds could represent a strategy to diminish osteoarthritis (OA) progression. The present study was undertaken to prove the uptake of nanoparticular dendritic polyglycerol sulfates (dPGS) by rat-derived articular chondrocytes and to answer the question of whether dPGS could modulate knee joint cartilage degradation in a rat OA model and whether complications could arise. METHODS: dPGS uptake and cytotoxicity was assessed in cultured primary rat-derived articular chondrocytes. Subsequently, OA was induced in the right knee joints of 12 male Wistar rats by medial collateral ligament and meniscus transection. Unoperated left knees remained as controls. Six weeks post surgery six rats were either treated daily (14 days) with 30 mg/kg dPGS (s.c.) or a similar volume of physiological saline. Animals were analyzed clinically for gait alterations. Explanted knee joints were studied histologically using OA scores according to Mankin (1971), Glasson et al., (2010) and the synovitis score according to Krenn et al., (2006). Liver, spleen and kidneys were analyzed for degenerative changes due to dPGS accumulation. RESULTS: dPGS was taken up after 2 hours by the chondrocytes. Whereas no significant clinical signs of OA could be detected, at the histological level, all operated rat knee joints revealed features of OA in the medial compartment. The values produced by both OA score systems were lower in rats treated with dPGS compared with saline-treated animals. Synovitis score did not significantly differ between the groups. The analyzed organs revealed no degenerative changes. CONCLUSIONS: dPGS presented overall cyto- and biocompatibility, no accumulation in metabolizing organs and chondroprotective properties in the osteoarthritic knee joint.


Asunto(s)
Condrocitos/metabolismo , Dendrímeros/metabolismo , Modelos Animales de Enfermedad , Glicerol/metabolismo , Nanopartículas/metabolismo , Osteoartritis de la Rodilla/metabolismo , Polímeros/metabolismo , Animales , Células Cultivadas , Condrocitos/efectos de los fármacos , Dendrímeros/administración & dosificación , Glicerol/administración & dosificación , Inyecciones Subcutáneas , Masculino , Nanopartículas/administración & dosificación , Osteoartritis de la Rodilla/tratamiento farmacológico , Osteoartritis de la Rodilla/patología , Polímeros/administración & dosificación , Ratas , Ratas Wistar , Sulfatos/administración & dosificación , Sulfatos/metabolismo
9.
Inflamm Res ; 64(11): 917-28, 2015 Nov.
Artículo en Inglés | MEDLINE | ID: mdl-26350038

RESUMEN

INTRODUCTION: Inflammatory processes driven by cytokines play a crucial role during osteoarthritis (OA) progression. Dendritic polyglycerol sulfate (dPGS) was analyzed in vitro for its effects on articular chondrocytes, cartilage and cytokines involved in the OA process. METHODS: The metabolic activity of cultured human articular chondrocytes stimulated for 24 h with dPGS (10(-3)-10(-6) mol/L) was monitored using AlamarBlue(®) assay. The dPGS uptake was studied using fluorescence labeled nanoparticles. Further, chondrocytes were either treated with 10(-6) M dPGS, TNFα (10 ng/mL) alone or with a combination of both. The influence on extracellular matrix components, pro- and anti-inflammatory cytokines, matrix metalloproteinase (MMP)1 and the anaphylatoxin receptor C3aR was analyzed by RTD-PCR, flow cytometry and ELISA. RESULTS: Even at higher dosages (10(-3) mol/L), dPGS did not influence chondrocytes viability. Uptake of dPGS was successfully monitored in human articular chondrocytes and synovial fibroblasts, penetration into cartilage chips was up to ~50 µm. Cellular treatment with dPGS had no effect on synthesis of pro-inflammatory cytokines TNFα and IL-6, but expression of the anti-inflammatory IL-10 was upregulated. Cotreatment with TNFα and dPGS reduced the TNFα level, while IL-1ß, IL-6 and IL-10 expression did not change. Collagen type II gene expression was significantly reduced after preincubating cells with dPGS, but remained unaffected at the protein level. CONCLUSION: Results indicate that dPGS could play a role in regulation of cytokines associated with the inflammatory aspect of OA progression.


Asunto(s)
Condrocitos/efectos de los fármacos , Dendrímeros/farmacología , Glicerol/farmacología , Polímeros/farmacología , Anciano , Anciano de 80 o más Años , Animales , Cartílago Articular/citología , Línea Celular , Células Cultivadas , Condrocitos/metabolismo , Colágeno Tipo II/genética , Colágeno Tipo II/metabolismo , Citocinas/metabolismo , Matriz Extracelular/metabolismo , Femenino , Fibroblastos/metabolismo , Regulación de la Expresión Génica/efectos de los fármacos , Humanos , Masculino , Ratones , Persona de Mediana Edad , Porcinos
10.
Bioconjug Chem ; 26(4): 773-81, 2015 Apr 15.
Artículo en Inglés | MEDLINE | ID: mdl-25811535

RESUMEN

The synthesis of water-soluble dyes, which absorb and emit in the range between 650 and 950 nm and display high extinction coefficients (ε) as well as high fluorescence quantum yields (Φf), is still a demand for optical imaging. We now present a synthetic route for the preparation of a new group of glycerol-substituted cyanine dyes from dendronized indole precursors that have been functionalized as N-hydroxysuccinimide (NHS) esters. High Φf values of up to 0.15 and extinction coefficients of up to 189 000 L mol(-1) cm(-1) were obtained for the pure dyes. Furthermore, conjugates of the new dendronized dyes with the antibody cetuximab (ctx) that were directed against the epidermal growth factor receptor (EGFR) of tumor cells could be prepared with dye to protein ratios between 0.3 and 2.2 to assess their potential as imaging probes. For the first time, ctx conjugates could be achieved without showing a decrease in Φf and with an increasing labeling degree that exceeded the value of the pure dye even at a labeling degree above 2. The incorporation of hydrophilically and sterically demanding dendrimers into cyanines prevented dimer formation after covalent conjugation to the antibody. The binding functionality of the resulting ctx conjugates to the EGFR was successfully demonstrated by cell microscopy studies using EGFR expressing cell lines. In summary, the combination of hydrophilic glycerol dendrons with reactive dye labels has been established for the first time and is a promising approach toward more powerful fluorescent labels with less dimerization.


Asunto(s)
Carbocianinas/química , Medios de Contraste/síntesis química , Dendrímeros/química , Colorantes Fluorescentes/síntesis química , Glicerol/química , Antineoplásicos/química , Antineoplásicos/farmacología , Línea Celular Tumoral , Cetuximab/química , Cetuximab/farmacología , Medios de Contraste/química , Células Epiteliales/efectos de los fármacos , Células Epiteliales/metabolismo , Células Epiteliales/patología , Receptores ErbB/antagonistas & inhibidores , Receptores ErbB/genética , Receptores ErbB/metabolismo , Colorantes Fluorescentes/química , Expresión Génica , Humanos , Interacciones Hidrofóbicas e Hidrofílicas , Inmunoconjugados/química , Inmunoconjugados/farmacología , Indoles/química , Microscopía Fluorescente , Imagen Óptica , Coloración y Etiquetado/métodos
11.
Circulation ; 131(16): 1426-34, 2015 Apr 21.
Artículo en Inglés | MEDLINE | ID: mdl-25810338

RESUMEN

BACKGROUND: The renin-angiotensin system and especially the angiotensin peptides play a central role in blood pressure regulation. Here, we hypothesize that an as-yet unknown peptide is involved in the action of angiotensin II modulating the vasoregulatory effects as a cofactor. METHODS AND RESULTS: The peptide with vasodilatory properties was isolated from adrenal glands chromatographically. The effects of this peptide were evaluated in vitro and in vivo, and the receptor affinity was analyzed. The plasma concentration in humans was quantified in patients with chronic kidney disease, patients with heart failure, and healthy control subjects. The amino acid sequence of the peptide from bovine adrenal glands was HSSYEDELSEVL EKPNDQAE PKEVTEEVSSKDAAE, which is a degradation product of chromogranin A. The sequence of the peptide isolated from human plasma was HSGFEDELSEVLENQSSQAELKEAVEEPSSKDVME. Both peptides diminished significantly the vasoconstrictive effect of angiotensin II in vitro. Therefore, we named the peptide vasoconstriction-inhibiting factor (VIF). The vasoregulatory effects of VIF are mediated by the angiotensin II type 2 receptor. VIF impairs angiotensin II-induced phosphorylation of the p38 mitogen-activated protein kinase pathway but not of extracellular-regulated kinase 1/2. The vasodilatory effects were confirmed in vivo. The plasma concentration was significantly increased in renal patients and patients with heart failure. CONCLUSIONS: VIF is a vasoregulatory peptide that modulates the vasoconstrictive effects of angiotensin II by acting on the angiotensin II type 2 receptor. It is likely that the increase in VIF may serve as a counterregulatory effect to defend against hypertension. The identification of this target may help us to understand the pathophysiology of renal and heart failure and may form a basis for the development of new strategies for the prevention and treatment of cardiovascular disease.


Asunto(s)
Glándulas Suprarrenales/química , Angiotensina II/fisiología , Péptidos/aislamiento & purificación , Receptor de Angiotensina Tipo 2/agonistas , Vasodilatación/efectos de los fármacos , Secuencia de Aminoácidos , Animales , Bovinos , Células Cultivadas , Cromogranina A/química , Células Endoteliales/efectos de los fármacos , Insuficiencia Cardíaca/sangre , Humanos , Sistema de Señalización de MAP Quinasas/efectos de los fármacos , Masculino , Ratones , Datos de Secuencia Molecular , Péptidos/sangre , Péptidos/química , Péptidos/fisiología , Procesamiento Proteico-Postraduccional/efectos de los fármacos , Ratas , Ratas Endogámicas WKY , Ratas Sprague-Dawley , Ratas Wistar , Insuficiencia Renal Crónica/sangre , Sistema Renina-Angiotensina/fisiología , Espectrometría de Masa por Láser de Matriz Asistida de Ionización Desorción , Proteínas Quinasas p38 Activadas por Mitógenos/metabolismo
12.
Nanoscale ; 7(9): 3923-32, 2015 Mar 07.
Artículo en Inglés | MEDLINE | ID: mdl-25516353

RESUMEN

In this study, dendritic polyglycerol sulfate (dPGS) is evaluated as a delivery platform for the anticancer, tubulin-binding drug paclitaxel (PTX). The conjugation of PTX to dPGS is conducted via a labile ester linkage. A non-sulfated dendritic polyglycerol (dPG) is used as a control, and the labeling with an indocarbocyanine dye (ICC) renders multifunctional conjugates that can be monitored by fluorescence microscopy. The conjugates are characterized by (1)H NMR, UV-vis measurements, and RP-HPLC. In vitro cytotoxicity of PTX and dendritic conjugates is evaluated using A549 and A431 cell lines, showing a reduced cytotoxic efficacy of the conjugates compared to PTX. The study of uptake kinetics reveals a linear, non saturable uptake in tumor cells for dPGS-PTX-ICC, while dPG-PTX-ICC is hardly taken up. Despite the marginal uptake of dPG-PTX-ICC, it prompts tubulin polymerization to a comparable extent as PTX. These observations suggest a fast ester hydrolysis and premature drug release, as confirmed by HPLC measurements in the presence of plasma enzymes.


Asunto(s)
Antineoplásicos Fitogénicos/química , Portadores de Fármacos/química , Glicerol/química , Paclitaxel/química , Polímeros/química , Antineoplásicos Fitogénicos/administración & dosificación , Antineoplásicos Fitogénicos/farmacología , Línea Celular Tumoral , Supervivencia Celular/efectos de los fármacos , Dendrímeros/química , Ésteres , Humanos , Concentración de Iones de Hidrógeno , Cinética , Microscopía Fluorescente , Paclitaxel/administración & dosificación , Paclitaxel/farmacología , Sulfatos/química
13.
Invest Ophthalmol Vis Sci ; 55(10): 6204-12, 2014 Sep 04.
Artículo en Inglés | MEDLINE | ID: mdl-25190666

RESUMEN

PURPOSE: We investigated a novel formulation of indocyanine green (ICG/HS 15) in an animal model of laser-induced choroidal neovascularization (CNV). METHODS: The ICG was formulated with the nonionic solubilizer and emulsifying agent Kolliphor HS 15 to create ICG/HS 15 to improve the chemical stability and fluorescence efficacy. In vivo imaging was performed in rats that had undergone laser photocoagulation. Retinal uptake and fluorescence intensity of ICG and ICG/HS 15 were compared following intravenous injection of 3 dosages (0.05, 0.1, and 0.15 mg/kg body weight) at 7, 14, and 21 days following laser treatment. Postmortem analysis included histology with frozen sections and flat mounts. RESULTS: Immediately following injection of ICG or ICG/HS 15, a strong fluorescence was visible in the retinal vasculature and at the site of laser lesions. Pixel intensity was higher for ICG/HS 15 compared to conventional ICG at 8 minutes after injection for all different injection days and dosages. Over time, a continuous decrease of the fluorescent signal was observed for up to 60 minutes to baseline level. Flow cytometry data showed an increased uptake of micellar dye of macrophages and endothelial cells. Histology revealed an accumulation of the micellar dye within the laser lesion. CONCLUSIONS: Micelle formulated ICG can be visualized in the retinal vasculature and laser-induced CNV in vivo and ex vivo. Micellar ICG/HS 15 showed in vivo stronger signal intensity when compared to ICG for all tested dosages. Following further investigations, ICG/HS 15 may be evaluated in patients with retinal and choroidal diseases for more refined diagnosis.


Asunto(s)
Neovascularización Coroidal/diagnóstico , Verde de Indocianina/farmacocinética , Oftalmoscopía/métodos , Animales , Neovascularización Coroidal/metabolismo , Colorantes , Modelos Animales de Enfermedad , Citometría de Flujo/métodos , Inmunohistoquímica , Terapia por Láser/efectos adversos , Masculino , Micelas , Ratas , Ratas Endogámicas
14.
J Control Release ; 194: 189-96, 2014 Nov 28.
Artículo en Inglés | MEDLINE | ID: mdl-25176577

RESUMEN

Herein we present a FRET-based theranostic macromolecular prodrug (TMP) composed of (a) dendritic polyglycerol (PG) as polymeric nanocarrier, (b) doxorubicin (Dox) linked via a pH-sensitive hydrazone to (c) a tri-functional linker, and (d) an indodicarbocyanine dye (IDCC) attached in close proximity to Dox. The drug fluorescence is quenched via intramolecular FRET until the pH-sensitive hydrazone bond between the TMP and Dox is cleaved at acidic pH. By measuring its fluorescence, we characterized the TMP cleavage kinetics at different pH values in vitro. The intracellular release of Dox from the carrier was monitored in real time in intact cancer cells, giving more insight into the mode of action of a polymer drug conjugate.


Asunto(s)
Antibióticos Antineoplásicos/administración & dosificación , Antibióticos Antineoplásicos/química , Doxorrubicina/administración & dosificación , Doxorrubicina/química , Transferencia Resonante de Energía de Fluorescencia/métodos , Profármacos/administración & dosificación , Profármacos/química , Diagnóstico por Imagen , Portadores de Fármacos/química , Colorantes Fluorescentes , Glicerol/química , Células HeLa , Humanos , Hidrazonas/química , Concentración de Iones de Hidrógeno , Cinética , Nanopartículas , Polímeros/química
15.
Macromol Biosci ; 14(9): 1215-21, 2014 Sep.
Artículo en Inglés | MEDLINE | ID: mdl-24863397

RESUMEN

Polyglycerol based nanogels (nPG) can function as cellular delivery systems. These nPGs are synthesized with different amine densities (nPG amines) by acid-catalyzed epoxide-opening polymerization using a mini-emulsion approach and surface modification. All the synthesized nanogels are characterized by NMR, dynamic light scattering, and ζ-potential, showing slightly positive surface charge and a homogeneous size of ≈100 nm. The use of these systems for delivery applications is demonstrated with regard to polyplex formation, cytotoxicity, and cellular uptake studies. It is depicted that the CE50 value of the high loaded nPG amines is eight times higher than the low loaded ones. The influence of the amine loading percentage on the nanogel and the effects of polyvalency in these architecture is discussed.


Asunto(s)
Aminas , ADN , Portadores de Fármacos , Glicerol , Ensayo de Materiales , Nanopartículas/química , Polímeros , Aminas/síntesis química , Aminas/química , Aminas/farmacología , Animales , Línea Celular , ADN/química , ADN/farmacología , Portadores de Fármacos/síntesis química , Portadores de Fármacos/química , Portadores de Fármacos/farmacología , Glicerol/síntesis química , Glicerol/química , Glicerol/farmacología , Luz , Espectroscopía de Resonancia Magnética , Ratones , Polímeros/síntesis química , Polímeros/química , Polímeros/farmacología , Dispersión de Radiación
16.
J Biomed Nanotechnol ; 10(1): 92-9, 2014 Jan.
Artículo en Inglés | MEDLINE | ID: mdl-24724501

RESUMEN

The development of effective polymer-based nanocarriers which are able to target diseased tissues still remains a great challenge in current research. Dendritic polyglycerols have emerged as novel polymeric scaffolds that have demonstrated a great potential for diverse biomedical applications. These architectures have already proven their usefulness in therapeutic approaches related to multivalency, given by the synergy between the nanosized dimensions combined with the high density of functional groups. However, a continuous effort is necessary to modify and tailor polyglycerol architectures to fit the future demands of biomedical applications. The present work deals with the development of a general synthetic strategy that allows the linkage of low molecular weight dendritic polyglycerols to fluorescent dyes and cell targeting ligands. The receptor mediated cellular uptake of the polyglycerol conjugates highlight their potential to acts as new targeted nanocarriers that should be able to decrease non-specific cellular uptake.


Asunto(s)
Dendrímeros/administración & dosificación , Glicerol/administración & dosificación , Terapia Molecular Dirigida/métodos , Polímeros/administración & dosificación , Receptores de Superficie Celular/química , Dendrímeros/química , Dendrímeros/farmacocinética , Portadores de Fármacos/síntesis química , Portadores de Fármacos/química , Portadores de Fármacos/farmacocinética , Sistemas de Liberación de Medicamentos , Colorantes Fluorescentes/química , Colorantes Fluorescentes/farmacocinética , Glicerol/química , Glicerol/farmacocinética , Hormona Liberadora de Gonadotropina/química , Hormona Liberadora de Gonadotropina/farmacocinética , Humanos , Maleimidas/administración & dosificación , Maleimidas/síntesis química , Maleimidas/química , Peso Molecular , Nanoconjugados/química , Oligopéptidos/química , Oligopéptidos/farmacocinética , Polímeros/química , Polímeros/farmacocinética , Receptores de Superficie Celular/metabolismo , Distribución Tisular , Células Tumorales Cultivadas
17.
Macromol Biosci ; 14(5): 643-54, 2014 May.
Artículo en Inglés | MEDLINE | ID: mdl-24446246

RESUMEN

In this study, the extent to which the scaffold architecture of polyglycerol sulfates affects inflammatory processes and hemocompatibility is investigated. Competitive L-selectin binding assays, cellular uptake studies, and blood compatibility readouts are done to evaluate distinct biological properties. Fully glycerol based hyperbranched polyglycerol architectures are obtained by either homopolymerization of glycidol (60% branching) or a new copolymerization strategy of glycidol with ethoxyethyl glycidyl ether. Two polyglycerols with 24 and 42% degree of branching (DB) are synthesized by using different monomer feed ratios. A perfectly branched polyglycerol dendrimer is synthesized according to an iterative two-step protocol based on allylation of the alcohol and subsequent catalytic dihydroxylation. All the polyglycerol sulfates are synthesized with a comparable molecular weight and degree of sulfation. The DB make the different polymer conjugates perform different ways. The optimal DB is 60% in all biological assays.


Asunto(s)
Dendrímeros/química , Glicerol/química , Inflamación/metabolismo , Polímeros/química , Sulfatos/química , Dendrímeros/síntesis química , Dendrímeros/metabolismo , Glicerol/metabolismo , Selectina L/metabolismo , Espectroscopía de Resonancia Magnética , Polímeros/metabolismo , Unión Proteica , Coloración y Etiquetado/métodos , Sulfatos/metabolismo
18.
Ophthalmologica ; 231(2): 117-23, 2014.
Artículo en Inglés | MEDLINE | ID: mdl-24217349

RESUMEN

PURPOSE: To investigate the use of imaging and quantitative measurement capabilities of a modified fundus camera in a rat model of laser-induced choroidal neovascularization. METHODS: Following induction of experimental choroidal neovascularization, Dark Agouti rats underwent serial in vivo imaging with a fundus camera (FF450plus, Carl Zeiss MediTec, Jena, Germany), including color, reflectance and fluorescence imaging. RESULTS: A custom-made setting allowed high-resolution imaging. Change of fluorescence intensity following intravenous or intravitreal dye injection could be quantitatively monitored over time. Hardware binning resulted in an improved signal-to-noise ratio and a reduction of flash light intensity. Simultaneous fluorescence imaging following injection of two different dendritic polygylcerol sulfate dyes could be demonstrated. CONCLUSION: This study demonstrates the use and optimizations of a fundus camera for various in vivo imaging modalities in rats. Molecular imaging of the eye may allow for better insights into cellular dysfunction and optimization of therapeutic strategies.


Asunto(s)
Coroides/patología , Neovascularización Coroidal/diagnóstico , Animales , Coroides/irrigación sanguínea , Diagnóstico Diferencial , Modelos Animales de Enfermedad , Angiografía con Fluoresceína , Fondo de Ojo , Aumento de la Imagen , Rayos Láser/efectos adversos , Masculino , Ratas , Ratas Endogámicas , Reproducibilidad de los Resultados
19.
Bioconjug Chem ; 24(9): 1507-14, 2013 Sep 18.
Artículo en Inglés | MEDLINE | ID: mdl-23924212

RESUMEN

Herein we describe a platform technology for the synthesis and characterization of partially aminated, (35)S-labeled, dendritic polyglycerol sulfate (dPG(35)S amine) and fluorescent dPGS indocarbocyanine (ICC) dye conjugates. These polymer conjugates, based on a biocompatible dendritic polyglycerol scaffold, exhibit a high affinity to inflamed tissue in vivo and represent promising candidates for therapeutic and diagnostic applications. By utilizing a one-step sequential copolymerization approach, dendritic polyglycerol (Mn ≈ 4.5 kDa) containing 9.4% N-phthalimide protected amine functionalities was prepared on a large scale. Sulfation and simultaneous radio labeling with (35)SO3 pyridine complex, followed by cleavage of the N-phthalimide protecting groups, yielded dPG(35)S amine as a beta emitting, inflammation specific probe with free amino functionalities for conjugation. Furthermore, efficient labeling procedures with ICC via iminothiolane modification and subsequent "Michael" addition of the maleimide functionalized ICC dye, as well as by amide formation via NHS derivatized ICC on a dPGS amine scaffold, are described. The dPGS-ICC conjugates were investigated with respect to their photophysical properties, and both the radiolabeled and fluorescent compounds were comparatively visualized in histological tissue sections (radio detection and fluorescence microscopy) of animals treated with dPGS. Furthermore, cellular uptake of dPGS-ICC was found in endothelial cord blood (HUVEC) and the epithelial lung cells (A549). The presented synthetic routes allow a reproducible, controlled synthesis of dPGS amine on kilogram scale applying a one-pot batch reaction process. dPGS amine can be used for analysis via radioactivity or fluorescence, thereby creating a new platform for inflammation specific, multimodal imaging purposes using other attachable probes or contrast agents.


Asunto(s)
Antiinflamatorios/química , Carbocianinas/química , Dendrímeros/química , Colorantes Fluorescentes/química , Glicerol/química , Polímeros/química , Sulfatos/química , Aminación , Animales , Antiinflamatorios/farmacocinética , Carbocianinas/farmacocinética , Línea Celular Tumoral , Dendrímeros/farmacocinética , Femenino , Colorantes Fluorescentes/farmacocinética , Glicerol/farmacocinética , Células Endoteliales de la Vena Umbilical Humana , Humanos , Ratones , Ratones Endogámicos BALB C , Modelos Moleculares , Polímeros/farmacocinética , Sulfatos/farmacocinética
20.
Bioconjug Chem ; 24(7): 1174-85, 2013 Jul 17.
Artículo en Inglés | MEDLINE | ID: mdl-23758616

RESUMEN

The rational design of bright optical probes and dye-biomolecule conjugates in the NIR-region requires fluorescent labels that retain their high fluorescence quantum yields when bound to a recognition unit or upon interaction with a target. Because hydrophilicity-controlled dye aggregation in conjunction with homo-FRET presents one of the major fluorescence deactivation pathways in dye-protein conjugates, fluorescent labels are required that enable higher labeling degrees with minimum dye aggregation. Aiming at a better understanding of the factors governing dye-dye interactions, we systematically studied the signal-relevant spectroscopic properties, hydrophilicity, and aggregation behavior of the novel xS-IDCC series of symmetric pentamethines equipped with two, four, and six sulfonic acid groups and selected conjugates of these dyes with IgG and the antibody cetuximab (ctx) directed against the cancer-related epidermal growth factor (EGF) receptor in comparison to the gold standard Cy5.5. With 6S-IDCC, which displays a molar absorption coefficient of 190 000 M(-1) cm(-1) and a fluorescence quantum yield (Φf) of 0.18 in aqueous media like PBS and nearly no aggregation, we could identify a fluorophore with a similarly good performance as Cy5.5. Bioconjugation of 6S-IDCC and Cy5.5 yielded highly emissive targeted probes with comparable Φf values of 0.29 for a dye-to-protein (D/P) ratio <1 and a reduced number of protein-bound dye aggregates in the case of 6S-IDCC. Binding studies of the ctx conjugates of both dyes performed by fluorescence microscopy and FACS revealed that the binding strength between the targeted probes and the EGF receptor at the cell membrane is independent of D/P ratio. These results underline the importance of an application-specific tuning of dye hydrophilicity for the design of bright fluorescent reporters and efficient optical probes. Moreover, we could demonstrate the potential of fluorescence spectroscopy to predict the size of fluorescence signals resulting for other fluorescence techniques such as FACS.


Asunto(s)
Colorantes Fluorescentes/química , Imagen Molecular , Sondas Moleculares , Línea Celular Tumoral , Cromatografía Líquida de Alta Presión , Dimerización , Humanos , Interacciones Hidrofóbicas e Hidrofílicas , Espectrometría de Fluorescencia
SELECCIÓN DE REFERENCIAS
DETALLE DE LA BÚSQUEDA