Your browser doesn't support javascript.
loading
Show: 20 | 50 | 100
Results 1 - 20 de 223
Filter
1.
Micromachines (Basel) ; 15(6)2024 Jun 15.
Article in English | MEDLINE | ID: mdl-38930759

ABSTRACT

In recent years, with the outbreak of the global energy crisis, renewable solar energy has become a focal point of research. However, the utilization efficiency of natural photosynthesis (NPS) is only about 1%. Inspired by NPS, artificial photosynthesis (APS) was developed and utilized in applications such as the regeneration of coenzymes. APS for coenzyme regeneration can overcome the problem of high energy consumption in comparison to electrocatalytic methods. Microreactors represent a promising technology. Compared with the conventional system, it has the advantages of a large specific surface area, the fast diffusion of small molecules, and high efficiency. Introducing microreactors can lead to more efficient, economical, and environmentally friendly coenzyme regeneration in artificial photosynthesis. This review begins with a brief introduction of APS and microreactors, and then summarizes research on traditional electrocatalytic coenzyme regeneration, as well as photocatalytic and photo-electrocatalysis coenzyme regeneration by APS, all based on microreactors, and compares them with the corresponding conventional system. Finally, it looks forward to the promising prospects of this technology.

2.
Open Med (Wars) ; 19(1): 20240982, 2024.
Article in English | MEDLINE | ID: mdl-38883336

ABSTRACT

Carnosine dipeptidase 1 (CNDP1), an enzyme integral to the hydrolysis of dipeptides containing histidine, plays an indispensable role in myriad physiological processes, including hydrolysis of proteins, maturation of specific biochemical functionalities within proteins, tissue regeneration, and regulation of cell cycle. However, the implications of CNDP1 in oncogenesis and its prognostic value are not yet fully elucidated. Initially, we procured the GSE40367 dataset from the Gene Expression Omnibus and established a protein-protein interaction network. Thereafter, we conducted functional and pathway enrichment analyses utilizing GO, KEGG, and GSEA. Moreover, we undertook an association analysis concerning the expression of CNDP1 with immune infiltration, along with survival analysis across various cancers and specifically in hepatocellular carcinoma (HCC). Our study uncovered a total of 2,248 differentially expressed genes, with a down-regulation of CNDP1 in HCC and other cancers. Our explorations into the relationship between CNDP1 and immune infiltration disclosed a negative correlation between CNDP1 expression and the presence of immune cells in HCC. Survival analyses revealed that diminished expression of CNDP1 correlates with an adverse prognosis in HCC and several other types of cancer. These observations intimate that CNDP1 holds promise as a novel prognostic biomarker for both pan-cancer and HCC.

3.
Lasers Surg Med ; 56(5): 466-473, 2024 07.
Article in English | MEDLINE | ID: mdl-38693708

ABSTRACT

OBJECTIVES: To investigate the efficacy of Fractional Radiofrequency Microneedling (FRM) in treating corticosteroid-induced facial erythema. METHODS: A retrospective study was conducted involving eight patients diagnosed as corticosteroid-induced facial erythema. Each patient underwent a single session of FRM. Evaluative measures included Clinician's Erythema Assessment (CEA), Patient's Self-Assessment (PSA), assessment of telangiectasia severity, procedure-associated pain (10-point scale), patient satisfaction (3-point scale) and secondary outcomes. RESULTS: The study found a 75% success rate and 100% effectiveness rate in alleviating erythema symptoms. CEA and PSA scores decreased by 67.7% and 78.1%, respectively. No cases of erythema rebound were recorded during the 3-month follow-up period. CONCLUSIONS: FRM demonstrated effectiveness and safety in treating facial erythema, offering promising advancement in dermatologic therapeutics.


Subject(s)
Erythema , Needles , Humans , Retrospective Studies , Female , Erythema/etiology , Erythema/therapy , Adult , Middle Aged , Male , Needles/adverse effects , Treatment Outcome , Radiofrequency Therapy/adverse effects , Facial Dermatoses/therapy , Adrenal Cortex Hormones/therapeutic use , Patient Satisfaction , Aged , Percutaneous Collagen Induction
4.
Entropy (Basel) ; 26(5)2024 May 15.
Article in English | MEDLINE | ID: mdl-38785671

ABSTRACT

Finite mixture of linear regression (FMLR) models are among the most exemplary statistical tools to deal with various heterogeneous data. In this paper, we introduce a new procedure to simultaneously determine the number of components and perform variable selection for the different regressions for FMLR models via an exponential power error distribution, which includes normal distributions and Laplace distributions as special cases. Under some regularity conditions, the consistency of order selection and the consistency of variable selection are established, and the asymptotic normality for the estimators of non-zero parameters is investigated. In addition, an efficient modified expectation-maximization (EM) algorithm and a majorization-maximization (MM) algorithm are proposed to implement the proposed optimization problem. Furthermore, we use the numerical simulations to demonstrate the finite sample performance of the proposed methodology. Finally, we apply the proposed approach to analyze a baseball salary data set. Results indicate that our proposed method obtains a smaller BIC value than the existing method.

5.
Front Surg ; 11: 1391718, 2024.
Article in English | MEDLINE | ID: mdl-38803548

ABSTRACT

Objective: To explore the clinical efficacy of intramedullary reduction techniques for irreducible intertrochanteric femoral fractures with negative medial cortical support. Methods: A retrospective analysis was conducted on 69 patients with irreducible intertrochanteric femoral fractures with negative medial cortical support treated in the Department of Orthopedics at Jiangsu Province Hospital (The First Affiliated Hospital of Nanjing Medical University) from July 2019 to December 2021. Patients were divided into Group A and Group B. Group A (experimental group) consisted of 36 cases with an average age of 76.2 ± 5.9 years, while Group B (control group) comprised 33 cases with an average age of 76.6 ± 6.3 years. Group A received treatment using intramedullary reduction techniques, while Group B received treatment using traditional extramedullary reduction techniques. Both groups achieved anatomic reduction of the medial cortex or slight positive support. Surgical duration, intraoperative fracture reduction time, intraoperative bleeding, intraoperative fluoroscopy time, fracture reduction quality, fracture healing, postoperative neck-shaft angle loss, femoral neck shortening, and hip joint functional recovery score (FRS) were compared between the two groups. Results: All patients were followed up for an average of 13.8 months. Group A showed superior outcomes compared to Group B in surgical duration, intraoperative fracture reduction time, intraoperative bleeding, intraoperative fluoroscopy time, fracture reduction quality, fracture healing, postoperative neck-shaft angle loss, and femoral neck shortening (P < 0.05). Hip joint function assessed by functional recovery score was better in Group A than Group B at 1 and 3 months postoperatively (P < 0.05), with no significant statistical difference at other time points (P > 0.05). Conclusion: For irreducible intertrochanteric femoral fractures with negative medial cortical support, intramedullary reduction techniques used during surgery demonstrated simplicity, significant reduction in surgical duration, decreased intraoperative bleeding, fewer amounts of intraoperative fluoroscopy, improved fracture reduction quality, and reduced surgical complexity. Further clinical research and application are warranted.

6.
Transl Oncol ; 45: 101986, 2024 Jul.
Article in English | MEDLINE | ID: mdl-38723299

ABSTRACT

Microvascular invasion (MVI) is an adverse prognostic indicator of tumor recurrence after surgery for hepatocellular carcinoma (HCC). Therefore, developing a nomogram for estimating the presence of MVI before liver resection is necessary. We retrospectively included 260 patients with pathologically confirmed HCC at the Fifth Medical Center of Chinese PLA General Hospital between January 2021 and April 2024. The patients were randomly divided into a training cohort (n = 182) for nomogram development, and a validation cohort (n = 78) to confirm the performance of the model (7:3 ratio). Significant clinical variables associated with MVI were then incorporated into the predictive nomogram using both univariate and multivariate logistic analyses. The predictive performance of the nomogram was assessed based on its discrimination, calibration, and clinical utility. Serum carnosine dipeptidase 1 ([CNDP1] OR 2.973; 95 % CI 1.167-7.575; p = 0.022), cirrhosis (OR 8.911; 95 % CI 1.922-41.318; p = 0.005), multiple tumors (OR 4.095; 95 % CI 1.374-12.205; p = 0.011), and tumor diameter ≥3 cm (OR 4.408; 95 % CI 1.780-10.919; p = 0.001) were independent predictors of MVI. Performance of the nomogram based on serum CNDP1, cirrhosis, number of tumors and tumor diameter was achieved with a concordance index of 0.833 (95 % CI 0.771-0.894) and 0.821 (95 % CI 0.720-0.922) in the training and validation cohorts, respectively. It fitted well in the calibration curves, and the decision curve analysis further confirmed its clinical usefulness. The nomogram, incorporating significant clinical variables and imaging features, successfully predicted the personalized risk of MVI in HCC preoperatively.

7.
Photodiagnosis Photodyn Ther ; 47: 104196, 2024 Jun.
Article in English | MEDLINE | ID: mdl-38710260

ABSTRACT

SIGNIFICANCE: Hemoporfin-mediated photodynamic therapy (HMME-PDT) has been recognized as a safe and effective treatment for port wine stain (PWS). However, some patients show limited improvement even after multiple treatments. Herein, we aim to explore the effect of autophagy on HMME-PDT in human umbilical vein endothelial cells (HUVECs), so as to provide theoretical basis and treatment strategies to enhance clinical effectiveness. METHODS: Establish the in vitro HMME-PDT system by HUVECs. Apoptosis and necrosis were identified by Annexin Ⅴ-FITC/PI flow cytometry, and autophagy flux was detected by monitoring RFP-GFP-LC3 under the fluorescence microscope. Hydroxychloroquine and rapamycin were employed in the mechanism study. Specifically, the certain genes and proteins were qualified by qPCR and Western Blot, respectively. The cytotoxicity was measured by CCK-8, VEGF-A secretion was determined by ELISA, and the tube formation of HUVECs was observed by angiogenesis assay. RESULTS: In vitro experiments revealed that autophagy and apoptosis coexisted in HUVECs treated by HMME-PDT. Apoptosis was dominant in early stage, while autophagy gradually increased in the middle and late stage. AMPK, AKT and mTOR participated in the regulation of autophagy induced by HMME-PDT, in which AMPK was positive regulation, while AKT and mTOR were negative regulation. Hydroxychloroquine could not inhibit HMME-PDT-induced autophagy, but capable of blocking the fusion of autophagosomes with lysosome. Rapamycin might cooperate with HMME-PDT to enhance autophagy in HUVECs, leading to increased cytotoxicity, reduced VEGF-A secretion, and weakened angiogenesis ability. CONCLUSIONS: Both autophagy and apoptosis contribute to HMME-PDT-induced HUVECs death. Pretreatment of HUVECs with rapamycin to induce autophagy might enhance the photodynamic killing effect of HMME-PDT on HUVECs. The combination of Rapamycin and HMME-PDT is expected to further improve the clinical efficacy.


Subject(s)
Apoptosis , Autophagy , Human Umbilical Vein Endothelial Cells , Photochemotherapy , Photosensitizing Agents , Sirolimus , Humans , Human Umbilical Vein Endothelial Cells/drug effects , Photochemotherapy/methods , Autophagy/drug effects , Photosensitizing Agents/pharmacology , Apoptosis/drug effects , Sirolimus/pharmacology , Hydroxychloroquine/pharmacology , Porphyrins/pharmacology , Vascular Endothelial Growth Factor A/metabolism
9.
Gut Microbes ; 16(1): 2328868, 2024.
Article in English | MEDLINE | ID: mdl-38485702

ABSTRACT

The role of gut fungal species in tumor-related processes remains largely unexplored, with most studies still focusing on fungal infections. This review examines the accumulating evidence suggesting the involvement of commensal and pathogenic fungi in cancer biological process, including oncogenesis, progression, and treatment response. Mechanisms explored include fungal influence on host immunity, secretion of bioactive toxins/metabolites, interaction with bacterial commensals, and migration to other tissues in certain types of cancers. Attempts to utilize fungal molecular signatures for cancer diagnosis and fungal-derived products for treatment are discussed. A few studies highlight fungi's impact on the responsiveness and sensitivity to chemotherapy, radiotherapy, immunotherapy, and fecal microbiota transplant. Given the limited understanding and techniques in fungal research, the studies on gut fungi are still facing great challenges, despite having great potentials.


Subject(s)
Gastrointestinal Microbiome , Mycobiome , Humans , Fungi/genetics , Carcinogenesis , Cell Transformation, Neoplastic
10.
Cell Host Microbe ; 32(4): 489-505.e5, 2024 Apr 10.
Article in English | MEDLINE | ID: mdl-38513657

ABSTRACT

Immunotherapy has revolutionized cancer treatment, but inconsistent responses persist. Our study delves into the intriguing phenomenon of enhanced immunotherapy sensitivity in older individuals with cancers. Through a meta-analysis encompassing 25 small-to-mid-sized trials of immune checkpoint blockade (ICB), we demonstrate that older individuals exhibit heightened responsiveness to ICB therapy. To understand the underlying mechanism, we reanalyze single-cell RNA sequencing (scRNA-seq) data from multiple studies and unveil distinct upregulation of exhausted and cytotoxic T cell markers within the tumor microenvironment (TME) of older patients. Recognizing the potential role of gut microbiota in modulating the efficacy of immunotherapy, we identify an aging-enriched enterotype linked to improved immunotherapy outcomes in older patients. Fecal microbiota transplantation experiments in mice confirm the therapeutic potential of the aging-enriched enterotype, enhancing treatment sensitivity and reshaping the TME. Our discoveries confront the prevailing paradox and provide encouraging paths for tailoring cancer immunotherapy strategies according to an individual's gut microbiome profile.


Subject(s)
Gastrointestinal Microbiome , Humans , Animals , Mice , Aged , Immune Checkpoint Inhibitors/pharmacology , Immune Checkpoint Inhibitors/therapeutic use , Immunotherapy , Aging , CD3 Complex
11.
Brief Bioinform ; 25(2)2024 Jan 22.
Article in English | MEDLINE | ID: mdl-38305453

ABSTRACT

Target enrichment sequencing techniques are gaining widespread use in the field of genomics, prized for their economic efficiency and swift processing times. However, their success depends on the performance of probes and the evenness of sequencing depth among each probe. To accurately predict probe coverage depth, a model called Deqformer is proposed in this study. Deqformer utilizes the oligonucleotides sequence of each probe, drawing inspiration from Watson-Crick base pairing and incorporating two BERT encoders to capture the underlying information from the forward and reverse probe strands, respectively. The encoded data are combined with a feed-forward network to make precise predictions of sequencing depth. The performance of Deqformer is evaluated on four different datasets: SNP panel with 38 200 probes, lncRNA panel with 2000 probes, synthetic panel with 5899 probes and HD-Marker panel for Yesso scallop with 11 000 probes. The SNP and synthetic panels achieve impressive factor 3 of accuracy (F3acc) of 96.24% and 99.66% in 5-fold cross-validation. F3acc rates of over 87.33% and 72.56% are obtained when training on the SNP panel and evaluating performance on the lncRNA and HD-Marker datasets, respectively. Our analysis reveals that Deqformer effectively captures hybridization patterns, making it robust for accurate predictions in various scenarios. Deqformer leads to a novel perspective for probe design pipeline, aiming to enhance efficiency and effectiveness in probe design tasks.


Subject(s)
Deep Learning , RNA, Long Noncoding , DNA Probes/genetics , Nucleic Acid Hybridization , Genomics
12.
STAR Protoc ; 5(1): 102847, 2024 Mar 15.
Article in English | MEDLINE | ID: mdl-38277270

ABSTRACT

Identifying fungal profiles from metagenomes is challenging due to an incomplete fungal database and limitations in the understanding of software. Here, we describe a protocol for analyzing the fecal metagenome of cancer patients prior to immunotherapy. We describe steps for raw metagenomic sequencing data retrieval, human genome and contaminants elimination, and assigning taxonomy labels to fungal reads. We then detail measures for assessing fungal alpha diversity and beta diversity, along with differential analysis. For complete details on the use and execution of this protocol, please refer to Xiaowen Huang et al.1.


Subject(s)
Metagenome , Neoplasms , Humans , Metagenome/genetics , Immunotherapy , Databases, Factual , Feces , Genome, Human , Neoplasms/genetics , Neoplasms/therapy
13.
Chem Biodivers ; 21(2): e202301383, 2024 Feb.
Article in English | MEDLINE | ID: mdl-38212902

ABSTRACT

Herba Epimedii is widely used to promote bone healing, and their active ingredients are total flavonoids of Epimedium (TFE). Ras homolog gene family member A / Rho-associated protein kinase (RhoA/Rock), an important pathway regulating the cytoskeleton, has been proven to affect bone formation. However, whether TFE promotes bone healing via this pathway remains unclear. In this study, the therapeutic effects of TFE were estimated using micro-computed tomography and hematoxylin and eosin staining of pathological sections. F-actin in osteoblasts was stained to investigate the protective effects of TFE on the cytoskeleton. Its regulatory effects on the RhoA/Rock1 pathway were explored using RT-qPCR and Western blot analysis. Besides, flow cytometry, alkaline phosphatase and nodule calcification staining were performed to evaluate the effects on osteogenesis. The bone healing in rats was improved, the cytoskeletal damage in osteoblasts was reduced, the RhoA/Rock1 pathway was downregulated, and osteogenesis was enhanced after TFE treatment. Thus, TFE can promote bone formation at least partially by regulating the expression of key genes and proteins in the cytoskeleton. The findings of this study provided evidence for clinical applications and would contribute to a better understanding of Epimedium's mechanisms in treating bone defects.


Subject(s)
Drugs, Chinese Herbal , Rats , Animals , X-Ray Microtomography , Drugs, Chinese Herbal/pharmacology , Drugs, Chinese Herbal/therapeutic use , Osteogenesis , Cytoskeleton
14.
Virol J ; 21(1): 10, 2024 01 05.
Article in English | MEDLINE | ID: mdl-38183109

ABSTRACT

Human papillomavirus (HPV) infection poses a significant threat to public health worldwide. Targeting the function of HPV E6 and E7 proteins and activating the host immune response against these proteins represent promising therapeutic strategies for combating HPV-related diseases. Consequently, the efficient production of soluble, high-purity E6 and E7 proteins is crucial for function and host immune response studies. In this context, we selected the pMCSG19 protein expression vector for Escherichia coli to produce soluble MBP-His6 tagged HPV11/16 E6/E7 proteins, achieving relatively high purity and yield. Notably, these proteins exhibited low toxicity to peripheral blood mononuclear cells (PBMCs) and did not compromise their viability. Additionally, the recombinant proteins were capable of inducing the secretion of multiple cytokines by immune cells in peripheral blood, indicating their potential to elicit immune responses. In conclusion, our study offers a novel approach for the production of HPV11/16 E6/E7 fusion proteins with relatively high purity and yield. The fusing HPV11/16 E6/E7 proteins to MBP-His6 tag may serve as a valuable method for large-scale protein production in future research endeavors.


Subject(s)
Leukocytes, Mononuclear , Papillomavirus Infections , Humans , Cytokines , Escherichia coli/genetics , Recombinant Proteins/genetics
15.
Genome Med ; 16(1): 16, 2024 Jan 19.
Article in English | MEDLINE | ID: mdl-38243343

ABSTRACT

BACKGROUND: The impact of the gut microbiome on the initiation and intensity of immune-related adverse events (irAEs) prompted by immune checkpoint inhibitors (ICIs) is widely acknowledged. Nevertheless, there is inconsistency in the gut microbial associations with irAEs reported across various studies. METHODS: We performed a comprehensive analysis leveraging a dataset that included published microbiome data (n = 317) and in-house generated data from 16S rRNA and shotgun metagenome samples of irAEs (n = 115). We utilized a machine learning-based approach, specifically the Random Forest (RF) algorithm, to construct a microbiome-based classifier capable of distinguishing between non-irAEs and irAEs. Additionally, we conducted a comprehensive analysis, integrating transcriptome and metagenome profiling, to explore potential underlying mechanisms. RESULTS: We identified specific microbial species capable of distinguishing between patients experiencing irAEs and non-irAEs. The RF classifier, developed using 14 microbial features, demonstrated robust discriminatory power between non-irAEs and irAEs (AUC = 0.88). Moreover, the predictive score from our classifier exhibited significant discriminative capability for identifying non-irAEs in two independent cohorts. Our functional analysis revealed that the altered microbiome in non-irAEs was characterized by an increased menaquinone biosynthesis, accompanied by elevated expression of rate-limiting enzymes menH and menC. Targeted metabolomics analysis further highlighted a notably higher abundance of menaquinone in the serum of patients who did not develop irAEs compared to the irAEs group. CONCLUSIONS: Our study underscores the potential of microbial biomarkers for predicting the onset of irAEs and highlights menaquinone, a metabolite derived from the microbiome community, as a possible selective therapeutic agent for modulating the occurrence of irAEs.


Subject(s)
Antineoplastic Agents, Immunological , Drug-Related Side Effects and Adverse Reactions , Gastrointestinal Microbiome , Immune System Diseases , Lung Neoplasms , Neoplasms , Humans , Neoplasms/drug therapy , Immune Checkpoint Inhibitors/therapeutic use , Antineoplastic Agents, Immunological/therapeutic use , RNA, Ribosomal, 16S/genetics , Vitamin K 2/therapeutic use , Immunotherapy/adverse effects , Programmed Cell Death 1 Receptor , Retrospective Studies , Lung Neoplasms/drug therapy
16.
IEEE Trans Pattern Anal Mach Intell ; 46(5): 3013-3030, 2024 May.
Article in English | MEDLINE | ID: mdl-38090825

ABSTRACT

Fast person re-identification (ReID) aims to search person images quickly and accurately. The main idea of recent fast ReID methods is the hashing algorithm, which learns compact binary codes and performs fast Hamming distance and counting sort. However, a very long code is needed for high accuracy (e.g., 2048), which compromises search speed. In this work, we introduce a new solution for fast ReID by formulating a novel Coarse-to-Fine (CtF) hashing code search strategy, which complementarily uses short and long codes, achieving both faster speed and better accuracy. It uses shorter codes to coarsely rank broad matching similarities and longer codes to refine only a few top candidates for more accurate instance ReID. Specifically, we design an All-in-One (AiO) module together with a Distance Threshold Optimization (DTO) algorithm. In AiO, we simultaneously learn and enhance multiple codes of different lengths in a single model. It learns multiple codes in a pyramid structure, and encourage shorter codes to mimic longer codes by self-distillation. DTO solves a complex threshold search problem by a simple optimization process, and the balance between accuracy and speed is easily controlled by a single parameter. It formulates the optimization target as a Fß score that can be optimised by Gaussian cumulative distribution functions. Besides, we find even short code (e.g., 32) still takes a long time under large-scale gallery due to the O(n) time complexity. To solve the problem, we propose a gallery-size-free latent-attributes-based One-Shot-Filter (OSF) strategy, that is always O(1) time complexity, to quickly filter major easy negative gallery images, Specifically, we design a Latent-Attribute-Learning (LAL) module supervised a Single-Direction-Metric (SDM) Loss. LAL is derived from principal component analysis (PCA) that keeps largest variance using shortest feature vector, meanwhile enabling batch and end-to-end learning. Every logit of a feature vector represents a meaningful attribute. SDM is carefully designed for fine-grained attribute supervision, outperforming common metrics such as Euclidean and Cosine metrics. Experimental results on 2 datasets show that CtF+OSF is not only 2% more accurate but also 5× faster than contemporary hashing ReID methods. Compared with non-hashing ReID methods, CtF is 50× faster with comparable accuracy. OSF further speeds CtF by 2× again and upto 10× in total with almost no accuracy drop.

17.
Gut ; 73(2): 268-281, 2024 Jan 05.
Article in English | MEDLINE | ID: mdl-37734910

ABSTRACT

BACKGROUND AND AIMS: Deregulation of RNA N6-methyladenosine (m6A) modification in intestinal epithelial cells (IECs) influences intestinal immune cells and leads to intestinal inflammation. We studied the function of fat mass-and obesity-associated protein (FTO), one of the m6A demethylases, in patients with ulcerative colitis (UC). METHODS: We analysed colon tissues of Ftoflox/flox; Villin-cre mice and their Ftoflox/flox littermates with dextran sulfate sodium (DSS) using real-time PCR and 16s rRNA sequencing. RNA and methylated RNA immunoprecipitation sequencing were used to analyse immunocytes and IECs. Macrophages were treated with conditioned medium of FTO-knockdown MODE-K cells or sphingosine-1-phosphate (S1P) and analysed for gene expression. Liquid chromatograph mass spectrometry identified C16-ceramide. RESULTS: FTO downregulation was identified in our in-house cohort and external cohorts of UC patients. Dysbiosis of gut microbiota, increased infiltration of proinflammatory macrophages, and enhanced differentiation of Th17 cells were observed in Ftoflox/flox;Villin-cre mice under DSS treatment. FTO deficiency resulted in an increase in m6A modification and a decrease in mRNA stability of CerS6, the gene encoding ceramide synthetase, leading to the downregulation of CerS6 and the accumulation of S1P in IECs. Subsequentially, the secretion of S1P by IECs triggered proinflammatory macrophages to secrete serum amyloid A protein 1/3, ultimately inducing Th17 cell differentiation. In addition, through bioinformatic analysis and experimental validation, we identified UC patients with lower FTO expression might respond better to vedolizumab treatment. CONCLUSIONS: FTO downregulation promoted UC by decreasing CerS6 expression, leading to increased S1P accumulation in IECs and aggravating colitis via m6A-dependent mechanisms. Lower FTO expression in UC patients may enhance their response to vedolizumab treatment.


Subject(s)
Colitis, Ulcerative , Colitis , Humans , Animals , Mice , Colitis, Ulcerative/metabolism , RNA, Ribosomal, 16S/metabolism , Intestinal Mucosa/metabolism , Colitis/chemically induced , Colitis/genetics , Colon/metabolism , Sphingolipids/metabolism , Dextran Sulfate , Disease Models, Animal , Mice, Inbred C57BL , Alpha-Ketoglutarate-Dependent Dioxygenase FTO/genetics , Alpha-Ketoglutarate-Dependent Dioxygenase FTO/metabolism
18.
CNS Neurosci Ther ; 30(4): e14483, 2024 04.
Article in English | MEDLINE | ID: mdl-37789643

ABSTRACT

BACKGROUND: Reperfusion therapy after ischemic stroke often causes brain microvascular injury. However, the underlying mechanisms are unclear. METHODS: Transcriptomic and proteomic analyses were performed on human cerebral microvascular endothelial cells following oxygen-glucose deprivation (OGD) or OGD plus recovery (OGD/R) to identify molecules and signaling pathways dysregulated by reperfusion. Major findings were further validated in a mouse model of cerebral ischemia and reperfusion. RESULTS: Transcriptomic analysis identified 390 differentially expressed genes (DEGs) between the OGD/R and OGD group. Pathway analysis indicated that these genes were mostly associated with inflammation, including the TNF signaling pathway, TGF-ß signaling pathway, cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway, and NF-κB signaling pathway. Proteomic analysis identified 201 differentially expressed proteins (DEPs), which were primarily associated with extracellular matrix destruction and remodeling, impairment of endothelial transport function, and inflammatory responses. Six genes (DUSP1, JUNB, NFKBIA, NR4A1, SERPINE1, and THBS1) were upregulated by OGD/R at both the mRNA and protein levels. In mice with cerebral ischemia and reperfusion, brain TNF signaling pathway was activated by reperfusion, and inhibiting TNF-α with adalimumab significantly attenuated reperfusion-induced brain endothelial inflammation. In addition, the protein level of THBS1 was substantially upregulated upon reperfusion in brain endothelial cells and the peri-endothelial area in mice receiving cerebral ischemia. CONCLUSION: Our study reveals the key molecular signatures of brain endothelial reperfusion injury and provides potential therapeutic targets for the treatment of brain microvascular injury after reperfusion therapy in ischemic stroke.


Subject(s)
Brain Injuries , Brain Ischemia , Ischemic Stroke , Reperfusion Injury , Mice , Humans , Animals , Endothelial Cells/metabolism , Proteomics , Brain/metabolism , Brain Ischemia/metabolism , Reperfusion Injury/metabolism , Oxygen , Brain Injuries/metabolism , Inflammation/metabolism , Reperfusion , Gene Expression Profiling , Ischemic Stroke/metabolism , Glucose/metabolism
19.
Zool Res ; 45(1): 108-124, 2024 Jan 18.
Article in English | MEDLINE | ID: mdl-38114437

ABSTRACT

Parkinson's disease (PD) is a neurodegenerative condition that results in dyskinesia, with oxidative stress playing a pivotal role in its progression. Antioxidant peptides may thus present therapeutic potential for PD. In this study, a novel cathelicidin peptide (Cath-KP; GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV) was identified from the skin of the Asiatic painted frog ( Kaloula pulchra). Structural analysis using circular dichroism and homology modeling revealed a unique αßß conformation for Cath-KP. In vitro experiments, including free radical scavenging and ferric-reducing antioxidant analyses, confirmed its antioxidant properties. Using the 1-methyl-4-phenylpyridinium ion (MPP +)-induced dopamine cell line and 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP)-induced PD mice, Cath-KP was found to penetrate cells and reach deep brain tissues, resulting in improved MPP +-induced cell viability and reduced oxidative stress-induced damage by promoting antioxidant enzyme expression and alleviating mitochondrial and intracellular reactive oxygen species accumulation through Sirtuin-1 (Sirt1)/Nuclear factor erythroid 2-related factor 2 (Nrf2) pathway activation. Both focal adhesion kinase (FAK) and p38 were also identified as regulatory elements. In the MPTP-induced PD mice, Cath-KP administration increased the number of tyrosine hydroxylase (TH)-positive neurons, restored TH content, and ameliorated dyskinesia. To the best of our knowledge, this study is the first to report on a cathelicidin peptide demonstrating potent antioxidant and neuroprotective properties in a PD model by targeting oxidative stress. These findings expand the known functions of cathelicidins, and hold promise for the development of therapeutic agents for PD.


Subject(s)
Dyskinesias , Neuroprotective Agents , Parkinson Disease , Animals , Mice , 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine/pharmacology , 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine/therapeutic use , 1-Methyl-4-phenylpyridinium/pharmacology , 1-Methyl-4-phenylpyridinium/therapeutic use , Antioxidants/pharmacology , Antioxidants/metabolism , Cathelicidins/metabolism , Dyskinesias/drug therapy , Dyskinesias/veterinary , Neuroprotective Agents/pharmacology , Neuroprotective Agents/therapeutic use , Oxidative Stress , Parkinson Disease/veterinary
20.
Eur J Pharmacol ; 963: 176275, 2024 Jan 15.
Article in English | MEDLINE | ID: mdl-38113968

ABSTRACT

Reperfusion therapy is currently the most effective treatment for acute ischemic stroke, but often results in secondary brain injury. Adipocyte fatty acid-binding protein (A-FABP, FABP4, or aP2) was shown to critically mediate cerebral ischemia/reperfusion (I/R) injury by exacerbating blood-brain barrier (BBB) disruption. However, no A-FABP inhibitors have been approved for clinical use due to safety issues. Here, we identified the therapeutic effect of levofloxacin, a widely used antibiotic displaying A-FABP inhibitory activity in vitro, on cerebral I/R injury and determined its target specificity and action mechanism in vivo. Using molecular docking and site-directed mutagenesis, we showed that levofloxacin inhibited A-FABP activity through interacting with the amino acid residue Asp76, Gln95, Arg126 of A-FABP. Accordingly, levofloxacin significantly inhibited A-FABP-induced JNK phosphorylation and expressions of proinflammatory factors and matrix metalloproteinase 9 (MMP-9) in mouse primary macrophages. In wild-type mice with transient middle cerebral artery occlusion, levofloxacin substantially mitigated BBB disruption and neuroinflammation, leading to reduced cerebral infarction, alleviated neurological outcomes, and improved survival. Mechanistically, levofloxacin decreased MMP-9 expression and activity, and thus reduced degradation of extracellular matrix and endothelial tight junction proteins. Importantly, the BBB- and neuro-protective effects of levofloxacin were abolished in A-FABP or MMP-9 knockout mice, suggesting that the therapeutic effects of levofloxacin highly depended on specific targeting of the A-FABP-MMP-9 axis. Overall, our study demonstrates that levofloxacin alleviates A-FABP-induced BBB disruption and neural tissue injury following cerebral I/R, and unveils its therapeutic potential for the treatment of ischemic stroke.


Subject(s)
Brain Ischemia , Ischemic Stroke , Reperfusion Injury , Animals , Mice , Rats , Blood-Brain Barrier/metabolism , Brain Ischemia/complications , Brain Ischemia/drug therapy , Infarction, Middle Cerebral Artery/metabolism , Ischemic Stroke/drug therapy , Levofloxacin/pharmacology , Levofloxacin/therapeutic use , Matrix Metalloproteinase 9/metabolism , Molecular Docking Simulation , Rats, Sprague-Dawley , Reperfusion , Reperfusion Injury/metabolism , Fatty Acid-Binding Proteins/drug effects , Fatty Acid-Binding Proteins/metabolism
SELECTION OF CITATIONS
SEARCH DETAIL
...