Estado nutricional, distribución de eventos alimentarios y actividad física en universitarios de Camagüey / Nutritional status, distribution of food events and physical activity in university students in Camagüey

RESUMEN Introducción: La promoción educativa sobre hábitos alimentarios saludables y práctica de actividad física en estudiantes universitarios constituye una estrategia eficaz de prevención de enfermedades crónicas no transmisibles. Para ello se necesita precisar requerimientos educativos específicos de este sector poblacional. Objetivo: Caracterizar el estado nutricional, la distribución de eventos alimentarios y la actividad física en los estudiantes de la Facultad de Ciencias Aplicadas de la Universidad de Camagüey. Método: Estudio descriptivo de corte transversal correlacional, en una muestra de 67 estudiantes durante 2019. El procesamiento estadístico de datos se realizó con el software Statgraphics Centurion XVI, versión 16.2.04. Un Análisis Multivariado permitió determinar la fuerza de asociación entre las variables estudiadas: Sexo, Año académico, Índice de masa corporal (IMC), Distribución de eventos alimentarios, Índice de actividad física y Tiempo sentado. Resultados: El 76,12 % de los estudiantes evaluados presentó peso saludable, de ellos, solo el 23,88 % refirió realizar actividad física programada en su tiempo libre, durante 150 minutos semanales. Conclusiones: Los universitarios estudiados presentaron un estado nutricional saludable, caracterizándose por omitir eventos alimentarios, principalmente el desayuno. Los niveles de actividad física programada en el tiempo libre son bajos, independientemente de que la mayoría presentaron niveles de actividad física entre media y alta.

ABSTRACT Introduction: The educational promotion on healthy eating habits and the practice of physical activity in university students constitutes an effective strategy for the prevention of chronic non-communicable diseases. For this, it is necessary to specify specific educational requirements for this population sector. Objective: To characterize the nutritional status, the distribution of food events and physical activity in the students of the Faculty of Applied Sciences of the University of Camagüey. Method: Descriptive correlational cross-sectional study, in a sample of 67 students, during 2019. Statistical data processing was performed with the Statgraphics Centurion XVI software, version 16.2.04. A Multivariate Analysis allowed determining the strength of association between the variables studied: Sex, Academic year, Body mass index (BMI), Distribution of eating events, Physical activity index and Time sitting. Results: 76.12 % of the evaluated students presented a healthy weight, of them, only 23.88 % referred to carrying out programmed physical activity in their free time, for 150 minutes per week. Conclusions: The university students studied presented a healthy nutritional state, characterized by omitting food events, mainly breakfast. The levels of physical activity programmed in free time are low, regardless of the fact that the majority presented levels of physical activity between medium and high.

Regresión de amiloidosis cardiaca tras un trasplante autólogo de células progenitoras en pacientes con hallazgos atípicos en la resonancia magnética / Regression of cardiac amyloidosis following autologous stem cell transplant in patients with atypical magnetic resonance imaging findings

No disponible

Reconstrucción mamaria inmediata con expansores tisulares / Immediate breast reconstruction with tissue expanders

RESUMEN Introducción: La reconstrucción mamaria postmastectomía es la forma habitual en nuestro país. En el Instituto de Oncología se realizan en la actualidad con sistematicidad de manera inmediata para disminuir el impacto psicológico de la mastectomía. Objetivo: Evaluar el comportamiento de la reconstrucción mamaria inmediata con el uso de expansores tisulares. Métodos: Se realizó un estudio observacional, descriptivo, retrospectivo y longitudinal, en pacientes ingresadas en el Instituto Nacional de Oncología y Radiología con criterios de reconstrucción mamaria inmediata con expansores tisulares, en el periodo comprendido entre octubre de 2015 a diciembre de 2018. El universo estuvo conformado por 51 paciente siendo la muestra 43. Resultados: Predominó la reconstrucción en mujeres entre 40 y 49 de color de la piel blanca. La mayoría con hábitos tóxicos de fumadoras. Se realizó como técnica quirúrgica la reconstrucción inmediata con expansión tisular, fue el más utilizado el anatómico. Las principales complicaciones estuvieron relacionadas con la radioterapia y hábitos tóxicos. Conclusiones: Todas las mujeres se reconstruyeron con expansor tisular, de forma inmediata, con bajo índice de complicaciones(AU)

ABSTRACT Introduction: Postmastectomy breast reconstruction is the usual way in our country. At the Oncology Institute they are currently performed systematically immediately to lessen the psychological impact of mastectomy. Objective: To evaluate the behavior of immediate breast reconstruction with the use of tissue expanders. Methods: An observational, descriptive, retrospective and longitudinal study was carried out in patients admitted to the National Institute of Oncology and Radiology with criteria for immediate breast reconstruction with tissue expanders, in the period from October 2015 to December 2018. The universe it was made up of 51 patients, sample 43. Results: Reconstruction predominated in women between 40 and 49 of white skin color. Most with toxic smoking habits. Immediate reconstruction with tissue expansion was performed as a surgical technique, anatomical was the most used. The main complications were related to radiation therapy and toxic habits. Conclusions: All the women were reconstructed with a tissue expander, immediately, with a low rate of complications(AU)

Índice de masa corporal y características clinicopatológicas de pacientes con cáncer de mama / Body mass index and clinical and pathological characteristics of breast cancer patients

Introducción: estudios previos han sugerido la relación del índice de masa corporal elevado con una mayor incidencia y un peor pronóstico del cáncer de mama. Objetivo: identificar la relación entre el índice de masa corporal en el momento del diagnóstico, y las características clinicopatológicas de pacientes con cáncer de mama de acuerdo con la presencia o no de menopausia. Métodos: estudio transversal y descriptivo de 47 mujeres, entre 36 y 84 años, con carcinoma ductal invasivo. Se midieron el peso y la estatura. Se calculó el índice de masa corporal para la clasificación de las pacientes en tres categorías: peso normal, sobrepeso y obesa. Se determinaron las características clinicopatológicas: tamaño del tumor, presencia de ganglios linfáticos metastásicos, etapa clínica, grado histológico y estado de los receptores de estrógeno, progesterona y receptor 2 para el factor de crecimiento epidérmico. Resultados: el índice de masa corporal varió en el rango de 18,54 a 44,92 kg/m2. No se observaron diferencias estadísticamente significativas entre los valores promedio globales de esta variable en las mujeres premenopáusicas y posmenopáusicas (26,76 kg/m2 ± 5,26 vs. 28,11 ± 5,61 kg/m2; p= 0,450), ni en el análisis realizado por categorías. La obesidad y el sobrepeso fueron asociados con un alto grado histológico, tanto en mujeres premenopáusicas (p= 0,038) como posmenopáusicas (p= 0,037). Adicionalmente, una asociación significativa entre el índice de masa corporal y el subtipo positivo al receptor de estrógenos o progesterona/receptor 2 para el factor de crecimiento epidérmico, se observó solo para las mujeres posmenopáusicas (p= 0,032). Conclusiones: estos resultados muestran que las mujeres obesas y con sobrepeso desarrollan fenotipos agresivos de cáncer de mama, independientemente de la presencia o no de menopausia. Además, entre las mujeres posmenopáusicas con índice de masa corporal elevado predominó el subtipo positivo al receptor de estrógenos o progesterona/receptor 2 para el factor de crecimiento epidérmico. Estudios futuros deberán realizarse para comprender los factores relevantes del hospedero y del tumor, para la prevención y el manejo clínico de las pacientes obesas con cáncer de mama(AU)

Introduction: previous studies have suggested the relationship of the high body mass index with higher incidence and bad prognosis of the breast cancer. Objective: to determine the relationship between the body mass index at the time of diagnosis of cancer, and the clinical-pathological characteristics of menopausal or non-menopausal breast cancer patients. Methods: descriptive and cross-sectional study of 47 women aged 36 to 84 years, with invasive duct carcinoma. Their weight and height were taken. Body mass index calculation served to classify the patients into 3 categories: normoweighed, overweighed and obese. The studied clinical-pathological characteristics were size of tumor, presence of metastatic lymph nodes, clinical staging, histological grade and state of estrogen receptor, progesterone receptor and 2 receptor for the epidermal growth factor. Results: the body mass index changed from 18.54 to 44.92 kg/m2. There were no statistically significant differences among the average overall values of this variable either in premenopausal and postmenopausal women ((26.76 kg/m2 ± 5.26 vs. 28.11 ± 5.61 kg/m2; p= 0.450) or in the analysis by categories. Obesity and overweight were associated to high histological grade both in premenopausal (p= 0.035) and postmenopausal women (p= 0.037). Additionally, a significant association was found between the body mass index and the estrogen or progesterone receptor /receptor 2-positive subtype (for the epidermal growth factor) in postmenopausal women (p= 0.032). Conclusions: these results show that obese and overweighed women may develop aggressive breast cancer phenotypes regardless of menopause. Moreover, the estrogen or progesterone receptor/receptor 2-positive subtype for the epidermal growth factor prevailed in postmenopausal women with high body mass index. Further studies should be conducted to better understand the relevant factors in the host and the tumor for the prevention and the clinical management of obese patients with breast cancer(AU)

Índice de masa corporal y características clinicopatológicas de pacientes con cáncer de mama / Body mass index and clinical and pathological characteristics of breast cancer patients

Introducción: estudios previos han sugerido la relación del índice de masa corporal elevado con una mayor incidencia y un peor pronóstico del cáncer de mama.Objetivo: identificar la relación entre el índice de masa corporal en el momento del diagnóstico, y las características clinicopatológicas de pacientes con cáncer de mama de acuerdo con la presencia o no de menopausia. Métodos: estudio transversal y descriptivo de 47 mujeres, entre 36 y 84 años, con carcinoma ductal invasivo. Se midieron el peso y la estatura. Se calculó el índice de masa corporal para la clasificación de las pacientes en tres categorías: peso normal, sobrepeso y obesa. Se determinaron las características clinicopatológicas: tamaño del tumor, presencia de ganglios linfáticos metastásicos, etapa clínica, grado histológico y estado de los receptores de estrógeno, progesterona y receptor 2 para el factor de crecimiento epidérmico.Resultados: el índice de masa corporal varió en el rango de 18,54 a 44,92 kg/m2. No se observaron diferencias estadísticamente significativas entre los valores promedio globales de esta variable en las mujeres premenopáusicas y posmenopáusicas (26,76 kg/m2 ± 5,26 vs. 28,11 ± 5,61 kg/m2; p= 0,450), ni en el análisis realizado por categorías. La obesidad y el sobrepeso fueron asociados con un alto grado histológico, tanto en mujeres premenopáusicas (p= 0,038) como posmenopáusicas (p= 0,037). Adicionalmente, una asociación significativa entre el índice de masa corporal y el subtipo positivo al receptor de estrógenos o progesterona/receptor 2 para el factor de crecimiento epidérmico, se observó solo para las mujeres posmenopáusicas (p= 0,032). Conclusiones: estos resultados muestran que las mujeres obesas y con sobrepeso desarrollan fenotipos agresivos de cáncer de mama, independientemente de la presencia o no de menopausia. Además, entre las mujeres posmenopáusicas con índice de masa corporal elevado predominó el subtipo positivo al receptor de estró....(AU)

Introduction: previous studies have suggested the relationship of the high body mass index with higher incidence and bad prognosis of the breast cancer.Objective: to determine the relationship between the body mass index at the time of diagnosis of cancer, and the clinical-pathological characteristics of menopausal or non-menopausal breast cancer patients.Methods: descriptive and cross-sectional study of 47 women aged 36 to 84 years, with invasive duct carcinoma. Their weight and height were taken. Body mass index calculation served to classify the patients into 3 categories: normoweighed, overweighed and obese. The studied clinical-pathological characteristics were size of tumor, presence of metastatic lymph nodes, clinical staging, histological grade and state of estrogen receptor, progesterone receptor and 2 receptor for the epidermal growth factor. Results: the body mass index changed from 18.54 to 44.92 kg/m2. There were no statistically significant differences among the average overall values of this variable either in premenopausal and postmenopausal women ((26.76 kg/m2 ± 5.26 vs. 28.11 ± 5.61 kg/m2; p= 0.450) or in the analysis by categories. Obesity and overweight were associated to high histological grade both in premenopausal (p= 0.035) and postmenopausal women (p= 0.037). Additionally, a significant association was found between the body mass index and the estrogen or progesterone receptor /receptor 2-positive subtype (for the epidermal growth factor) in postmenopausal women (p= 0.032). Conclusions: these results show that obese and overweighed women may develop aggressive breast cancer phenotypes regardless of menopause. Moreover, the estrogen or progesterone receptor/receptor 2-positive subtype for the epidermal growth factor prevailed in postmenopausal women with high body mass index. Further studies should be conducted to... (AU)

Characterisation of Plasmodium falciparum RESA-like protein peptides that bind specifically to erythrocytes and inhibit invasion.

The Plasmodium falciparum ring-erythrocyte surface antigen (RESA)-like putative protein was identified and characterised. PCR and RT-PCR assays revealed that the gene encoding this protein was both present and being transcribed in P. falciparum strain FCB-2 16 h after erythrocyte invasion. Indirect immunofluorescence studies detected this protein in infected erythrocyte (IE) cytosol in dense fluorescent granules similar to Maurer's clefts at 16-20 h (parasites in ring and trophozoite stages) and very strongly on IE membranes at 22 h, suggesting that it is synthesised during early ring stages (16 h) and transported to the infected red blood cell (RBC) membrane surface during the trophozoite stage (22 h). Western blotting showed that antisera produced against polymerised synthetic peptides of this protein recognised a 72-kDa band in P. falciparum schizont lysate. P. falciparum RESA-like peptides used in normal RBC binding assays revealed that peptides 30326 ((101)NAEKI LGFDD KNILE ALDLFY(120)), 30334 ((281)RVTWK KLRTK MIKAL KKSLTY(300)) and 30342 ((431)SSPQR LKFTA GGGFC GKLRNY(450)) bind with high activity and saturability, presenting nM affinity constants. These peptides contain alpha-helical structural elements, as determined by circular dichroism, and inhibit P. falciparum in vitro invasion of normal RBCs by up to 91%, suggesting that some RESA-like protein regions are involved in intra-erythrocyte stage P. falciparum invasion.

Functional, structural, and immunological compartmentalisation of malaria invasive proteins.

Conserved Plasmodium falciparum merozoite high activity binding peptides (HABPs) involved in red blood cell (RBC) invasion which are present in merozoite surface proteins (MSPs) involved in attachment, rolling over RBC, those derived from soluble proteins loosely bound to the membrane, and those present in microneme and rhoptry organelles have an alpha-helical structure and bind with high affinity to HLA-DR52 molecules. On the contrary, conserved HABPs belonging to molecules anchored to the membrane by a GPI tail, or a transmembranal region, or those molecules presenting PEXEL motifs have a strand, turn or unordered configuration and bind with high affinity to HLA-DR53 molecules. Such functional, cellular, structural, and immunological compartmentalisation has tremendous implications in subunit-based, multi-epitope, synthetic, anti-malarial vaccine development.

Identifying Plasmodium falciparum merozoite surface protein-10 human erythrocyte specific binding regions.

Receptor-ligand interactions between synthetic peptides and normal human erythrocytes were studied to determine P. falciparum merozoite surface protein-10 (MSP-10) regions specifically binding to membrane surface receptors on human erythrocytes. Three MSP-10 protein High Activity Binding Peptides (HABPs) were identified, whose binding to erythrocytes became saturable and sensitive on being treated with neuraminidase, trypsin and chymotrypsin. Some of them specifically recognised a 50 kDa erythrocyte membrane protein. Some HABPs inhibited in vitro P. falciparum merozoite invasion of erythrocytes by 70%, suggesting that MSP-10 protein's possible role in the invasion process probably functions by using similar mechanisms to those described for other MSP family antigens. In addition to above results, the high homology in amino-acid sequence and superimposition of both MSP-10, MSP-8 and MSP-1 EGF-like domains and HABPs 31132, 26373 and 5501 suggest that tridimensional structure could be playing an important role in the invasion process and in designing synthetic multi-stage anti-malarial vaccines.

Identification of Plasmodium falciparum reticulocyte binding protein RBP-2 homologue a and b (PfRBP-2-Ha and -Hb) sequences that specifically bind to erythrocytes.

Plasmodium falciparum reticulocyte binding protein RBP-2 homologues a and b (PfRBP-2-Ha and -Hb) have been described as being high molecular weight proteins, expressed at the P. falciparum merozoite apical extreme, belonging to a family of proteins found in other Plasmodium involved in the search for erythrocyte populations before being invaded by merozoites. 185, 20-mer-long non-overlapping peptides, spanning the entire PfRBP-2-Ha and -Hb sequences, were synthesised, radiolabelled and tested in erythrocyte binding assays. Fifteen PfRBP-2-Ha and -Hb high binding activity peptides (HBAPs) specifically binding to erythrocytes with high affinity were identified. Dissociation constants were between 70 and 300 nM and Hill coefficients were 1 approximately. HBAPs residues critical for binding to erythrocytes were determined. Cross-linking was performed allowing possible receptors for PfRBP-2-Ha and -Hb to be identified on the surface of the erythrocytes. Some of the HABPs showed merozoite invasion inhibition greater than 90% in in vitro assays.

Identification of specific Hep G2 cell binding regions in Plasmodium falciparum sporozoite-threonine-asparagine-rich protein (STARP).

It has been demonstrated that Plasmodium falciparum sporozoite threonine-asparagine-rich protein (PfSTARP) is located on the sporozoite surface. This protein's non-overlapping consecutive peptides were synthesised and tested in Hep G2 cell binding assays. Twelve high activity binding peptides (HABPs) were identified in the resulting 31 peptides. Three were found in 5' non-repeat region (amino acids 41-80). Peptides 20546 (41VIKHNRFLSEYQSNFLGGGY(60)), 20547 (61SAALKLVNSKKSGTNVNVTKY(80)) and 20548 (81NSENTNTNNNIPESSSTYTN(100)) were located in the conserved amino terminal region, as well as peptide 20548 which shared the sequence with the M region (amino acids 85-134). Six HABPs were located in region 10 (Rp10) (STDNNNTKTI). HABPs 20569 (501TSDDELNKDSCDYSEEKENI(520)) and 20570 (521KSMINAYLDKLDLETVRKIH(40)) were found in 3' non-repeat region. All these HABPs showed saturable binding and presented dissociation constants between 18 and 219 nM. The number of binding sites per Hep G2 cell ranged from 45000 to 370000. High binding peptides' critical amino acids involved in Hep G2 cell binding were determined by competition binding assays. SDS-PAGE results showed that both peptides 20570 and 20547 had at least two different sets of 44 and 38 kDa HABP receptors on Hep G2 cells. Specific modification of peptide 20546 and 20570 critical binding residues rendered these peptides immunogenic in Aotus monkeys, inducing high antibody titres against sporozoites, as assessed by IFA.

Hepatitis C virus (HCV) E1 and E2 protein regions that specifically bind to HepG2 cells.

BACKGROUND/AIMS: Identify hepatitis C virus (HCV) sequences in E1 and E2 protein binding to HepG2. METHODS: Synthetic 20-mer long, ten-residue overlapped peptides, from E1 and E2 proteins, were tested in HepG2 or Raji cell-binding assays. Affinity constants, binding site number per cell and Hill coefficients were determined by saturation assay for high activity binding peptides (HABPs). Receptors for HepG2 cell were determined by cross-linking and sodium dodecyl sulfate-polyacrylamide gel electrophoresis analysis. RESULTS: Twelve HABPs were found in HCV genotype 1a, allowing six hepatocyte-binding sequences (HBSs) to be defined: two peptide-binding regions in E1 HABPs 4913 (YQVRNSTGLYHVTNDCPNSS) and 4918 (MTPTVATRDGKLPATQLRRHY). Four hepatocyte-binding regions were defined in E2: region-I, peptide 4931 (ETHVTGGSAGHTVSGFVSLLY); region-II, 4937-4939 (HHKFNSSGCPERLASCRPLTDFDQGWGPISYANGSGPDQR); region-III, 4943-4945 (PVYCFTPSPVVVGTTDRSGAPTYSWGENDTDVFVLNNTR) and region-IV, 4949-4952 (CGAPPCVIGGAGNNTLHCPTDCFRKHPDATYSRCGSGPWITPRCLVDYPY). The underlined sequences are most relevant in the binding process. HABPs 4913 and 4938 also bind to CD81 positive Raji cells. Region-II 4938 HABPs bind to 50 and 60kDa HepG2 cell membrane surface proteins. CONCLUSIONS: Six HVRs to the HepG2 were identified. Some HABPs have been previously found to be antigenic and immunogenic. HABPs, 4918 (from E1), 4938, 4949, 4950, 4951 and 4952 (from E2) have not been previously recognised. These HABPs could be relevant to HCV invasion of hepatocytes.

Plasmodium vivax MSP-1 peptides have high specific binding activity to human reticulocytes.

Plasmodium vivax merozoites have high preferential ability to interact with and invade reticulocytes, although these cells correspond to only 2% of the red blood cells (RBC) population. P. vivax merozoite surface protein-1 (Pv-MSP-1) is believed to have an important role in attachment and invasion process. Using 88 non-overlapping 20-mer peptides, covering the entire Pv-MSP-1 Belem strain sequence, RBC and reticulocyte binding assays were performed. Fourteen sequences were identified with high specific binding activity to reticulocytes, but only three had high specific binding activity to mature erythrocytes. These peptides showed affinity constant values between 20 and 150nM, indicating a strong interaction between these sequences and reticulocyte receptors. Critical residues in binding to reticulocytes for these peptides were determined by competition binding assays with glycine scanning analogues. All high binding peptides bind to reticulocyte surface proteins having a molecular mass of around 18-20kDa which are not present in mature RBC. Interestingly, some high activity binding peptides (HABPs) are located close to the hypothesised 42 and 19kDa fragment cleavage sites for this protein, suggesting that these sequences have an important role in target cell attachment and invasion process by Pv-MSP-1.HABPs may be clustered in two regions, with region I being located between amino acids 280-719, and region II between amino acids 1060-1599 with higher than 25% identity level. A P. falciparum MSP-1 antigenic domain binds to RBCs and inhibits parasite invasion. Peptides 1721 and 1724 bind with high activity to reticulocytes in homologous Pv-MSP-1, suggesting similar functions for these two sequences.