RESUMEN
RESUMEN Objetivo: Determinar la prevalencia del síndrome de agotamiento profesional (burnout) y las variables asociadas en médicos especialistas. Métodos: Estudio observacional, descriptivo y transversal, mediante censo de médicos especialistas de 3 hospitales regionales (n = 540), ficha de identificación y Maslach Burnout Inventory-Human Services Survey autoaplicado. Se realizaron estadísticas descriptivas y el análisis inferencial con SPSS 15.0 y Epi-infoV6.1. Resultados: Un 90,0% de los especialistas estudiados respondieron. Se detectó burnout en el 45,9%. Hubo diferencias significativas en las variables: ser mujer; la edad <40 arios; no tener pareja estable o llevar menos de 15 años con ella; que la pareja trabaje; no tener hijos; especialidad clínica; menos de 10 años de antigüedad profesional y en el puesto actual de trabajo, y laborar jornada acumulada. Correlación negativa: burnout con agotamiento emocional y con despersonalización. Positiva con la falta de realización personal en el trabajo. Conclusiones: El burnout es frecuente (45,9%) entre los médicos especialistas. Los niveles medios de las subescalas se encuentran cerca de la normalidad. La afección por el agotamiento emocional y la despersonalización se comportan inversamente proporcionales con la puntuación total del síndrome, y directamente proporcionales con la falta de realización personal en el trabajo con burnout.
ABSTRACT Objective: To determine the prevalence of burnout syndrome and the associated variables in medical specialists in Mexico. Methods: Observational, descriptive and cross-sectional study, by means of a census of 540 medical specialists from three Regional Hospitals. Using their identification card and self-administered Maslach Burnout Inventory-Human Services questionnaire, descriptive statistics and inferential analysis were performed using SPSS 15.0 and Epi-infoV6.1. Results: There was a 90.0% response in the specialists studied. Burnout was detected in 45.9%. There were significant differences in variables: being female; under 40 years of age; without a stable partner, and less than 15 years together; a working couple; childless; clinical specialty; less than 10 years of professional and current employment, and accumulated work day. A negative correlation was found in burnout with emotional exhaustion, and with depersonalisation. It was positive with a lack of personal fulfilment at work. Conclusions: Burnout is common (45.9%) in specialist physicians. The average levels of the subscales are close to normal. Emotional exhaustion and depersonalisation behave inversely proportional to the total score of the syndrome, and directly proportional to the lack of personal fulfilment in the work with burnout.
RESUMEN
Antimicrobial peptides (AMPs) have been recognised as a significant therapeutic option for mitigating resistant microbial infections. It has been found recently that Plasmodium falciparum-derived, 20 residue long, peptide 35409 had antibacterial and haemolytic activity, making it an AMP having reduced selectivity, and suggesting that it should be studied more extensively for obtaining new AMPs having activity solely targeting the bacterial membrane. Peptide 35409 was thus used as template for producing short synthetic peptides (<20 residues long) and evaluating their biological activity and relevant physicochemical characteristics for therapeutic use. Four of the sixteen short peptides evaluated here had activity against E. coli without any associated haemolytic effects. The 35409-1 derivative (17 residues long) had the best therapeutic characteristics as it had high selectivity for bacterial cells, stability in the presence of human sera, activity against E. coli multiresistant clinical isolates and was shorter than the original sequence. It had a powerful membranolytic effect and low potential for inducing resistance in bacteria. This peptide's characteristics highlighted its potential as an alternative for combating infection caused by E. coli multiresistant bacteria and/or for designing new AMPs.
RESUMEN
BACKGROUND: One of the most important psychosocial factors to which doctors are exposed is the burnout syndrome, whose origin is possibly the chronic stress experienced during the development of their professional practice. OBJECTIVE: To determine the prevalence of burnout syndrome in medical specialists and risk factors. MATERIAL AND METHODS: Observational, descriptive and cross-sectional study, census of medical specialists physicians in a regional hospital, with the participation of 196 of them, identification card and self-administered Maslach Burnout Inventory-Human Services Survey participated. Descriptive statistics and inferential analysis with SPSS 15.0 Epidat 3.1. RESULTS: 86.7% response. Burnout at 45.9%. Significant differences in those under 40 and under 15 with a stable partner. With the syndrome, a negative correlation was observed between emotional exhaustion and depersonalization and positive with a lack of personal accomplishment at work. CONCLUSIONS: Burnout is frequent (45.9%) in medical specialists, therefore, it is considered necessary to establish preventive or intervention measures to reduce the prevalence found.
INTRODUCCIÓN: Uno de los factores psicosociales más importantes a los que los médicos están expuestos es el síndrome de desgaste profesional (burnout), cuyo origen es posiblemente el estrés crónico experimentado durante el desarrollo de su práctica profesional. OBJETIVO: Determinar la prevalencia del síndrome de desgaste profesional en médicos especialistas y los factores de riesgo. MATERIAL Y MÉTODOS: Estudio observacional, descriptivo y transversal, censo de médicos especialistas de un hospital regional, con participación de 196 de ellos, ficha identificación y Maslach Burnout Inventory-Human Services Survey auto-administrado. Estadísticas descriptivas y análisis inferencial con SPSS 15.0 y Epidat 3.1. RESULTADOS: 86,7% de respuesta. Burnout en 45,9%. Diferencias significativas en menores de 40 años y menos de 15 años con pareja estable. Con el síndrome se observó una correlación negativa entre agotamiento emocional y despersonalización y positiva con falta de realización personal en el trabajo. CONCLUSIONES: El burnout es frecuente (45,9%) en los médicos especialistas, por lo que se considera necesario establecer medidas preventivas o de intervención para reducir la prevalencia encontrada.
Asunto(s)
Agotamiento Profesional , Agotamiento Profesional/diagnóstico , Agotamiento Profesional/epidemiología , Agotamiento Profesional/etiología , Agotamiento Psicológico/epidemiología , Agotamiento Psicológico/etiología , Estudios Transversales , Humanos , Prevalencia , Factores de Riesgo , Especialización , Encuestas y CuestionariosRESUMEN
OBJECTIVE: To determine the prevalence of burnout syndrome and the associated variables in medical specialists in Mexico. METHODS: Observational, descriptive and cross-sectional study, by means of a census of 540 medical specialists from three Regional Hospitals. Using their identification card and self-administered Maslach Burnout Inventory-Human Services questionnaire, descriptive statistics and inferential analysis were performed using SPSS 15.0 and Epi-infoV6.1. RESULTS: There was a 90.0% response in the specialists studied. Burnout was detected in 45.9%. There were significant differences in variables: being female; under 40 years of age; without a stable partner, and less than 15 years together; a working couple; childless; clinical specialty; less than 10 years of professional and current employment, and accumulated work day. A negative correlation was found in burnout with emotional exhaustion, and with depersonalisation. It was positive with a lack of personal fulfilment at work. CONCLUSIONS: Burnout is common (45.9%) in specialist physicians. The average levels of the subscales are close to normal. Emotional exhaustion and depersonalisation behave inversely proportional to the total score of the syndrome, and directly proportional to the lack of personal fulfilment in the work with burnout.
RESUMEN
In Mexico, as in the entire Western world, during the 19th century and the beginnings of the 20th century, medical knowledge developed in a remarkable way and the case of diabetes mellitus was not the exception. This situation, which arose on the basis of the antique paradigm, and which in turn was overthrown by the positivism as the emergent paradigm (with its clinical and anatomical, as well as physiopathological and etiopathological viewpoints), was reflected during the 19th the century through its actors and the communications that opened the access of Mexican medicine to the modernity.
En México, como en el mundo occidental, durante el siglo XIX y principios del XX, el conocimiento médico presentó un desarrollo notable y el caso de la diabetes mellitus no es la excepción. Esta situación, originada desde el paradigma antiguo, superado por el paradigma moderno emergente, con sus miradas anatomoclínica, fisiopatológica y etiopatogénica, se refleja en el México decimonónico a través de sus actores y de las comunicaciones que inauguran la entrada de la medicina mexicana a la modernidad.
Asunto(s)
Diabetes Mellitus/historia , Diabetes Mellitus/etiología , Diabetes Mellitus/fisiopatología , Educación Médica/historia , Historia del Siglo XIX , Historia del Siglo XX , Humanos , México , Filosofía Médica/historiaRESUMEN
Oral squamous cell carcinoma is the fifth most common epithelial cancer in the world, and its current clinical treatment has both low efficiency and poor selectivity. Cationic amphipathic peptides have been proposed as new drugs for the treatment of different types of cancer. The main goal of the present work was to determine the potential of LfcinB(20-25)4, a tetrameric peptide based on the core sequence RRWQWR of bovine lactoferricin LfcinB(20-25), for the treatment of OSCC. In brief, OSCC was induced in the buccal pouch of hamsters by applying 7,12-Dimethylbenz(a)anthracene, and tumors were treated with one of the following peptides: LfcinB(20-25)4, LfcinB(20-25), or vehicle (control). Lesions were macroscopically evaluated every two days and both histological and serum IgG assessments were conducted after 5 weeks. The size of the tumors treated with LfcinB(20-25)4 and LfcinB(20-25) was smaller than that of the control group (46.16±4.41 and 33.92±2.74 mm3 versus 88.77±10.61 mm3, respectively). Also, LfcinB(20-25)4 caused acellularity in the parenchymal tumor compared with LfcinB(20-25) and vehicle treatments. Furthermore, our results demonstrated that both LfcinB(20-25)4 and LfcinB(20-25) induced higher degree of apoptosis relative to the untreated tumors (75-86% vs 8%, respectively). Moreover, although the lowest inflammatory response was achieved when LfcinB(20-25)4 was used, this peptide appeared to induce higher levels of IgG antibodies relative to the vehicle and LfcinB(20-25). In addition the cellular damage and selectivity of the LfcinB(20-25)4 peptide was evaluated in vitro. These assays showed that LfcinB(20-25)4 triggers a selective necrotic effect in the carcinoma cell line. Cumulatively, these data indicate that LfcinB(20-25)4 could be considered as a new therapeutic agent for the treatment of OSCC.
Asunto(s)
Carcinoma de Células Escamosas/tratamiento farmacológico , Lactoferrina/administración & dosificación , Neoplasias de la Boca/tratamiento farmacológico , Péptidos/administración & dosificación , Animales , Apoptosis/efectos de los fármacos , Carcinoma de Células Escamosas/patología , Bovinos , Proliferación Celular/efectos de los fármacos , Humanos , Células Jurkat , Lactoferrina/química , Neoplasias de la Boca/patología , Péptidos/químicaRESUMEN
Infection plays a critical role in health care and impacts the cost of the treatment of diabetic foot ulcers (DFU). To examine the cost reduction associated with the multidisciplinary treatment of infected DFU (IDFU) by obtaining early (ie, within 48 hours of admission) microbiological culture results, a descriptive, longitudinal study was conducted. Data were collected prospectively from patient medical charts of a cohort of 67 patients (mean age, 56.14 ± 12.3 years; mean duration of diabetes, 14.95 ± 8 years) with IDFU treated at a Mexican public health facility from January 1 to April 30, 2010. Information included demographic data (age, gender, marital status, time elapsed since first diagnosis of diabetes mellitus type 2 [DM2]), and the following clinical records: Wagner classification, bacterium type, antimicrobial resistance, length of hospital stay, and the antibiotic schedule utilized, as well as number and type of laboratory tests, medications, intravenous therapy, surgical and supportive treatment, type and number of specialists, and clinical outcome. Microcosting was used to calculate the unit cost of each medical treatment element. Using the Monte Carlo and Markov predictive simulation economical models, cost reduction associated with early identification of the specific microorganism through bacterial culture in IDFU was estimated. Based on the statistical results, differences between real and estimated costs when including early microbiological culture were identified and the number and type of most common species of infectious bacteria were detected. The total cost observed in the patient cohort was $502 438.04 USD, mean cost per patient was $7177.69 ± $5043.51 USD, and 72.75% of the total cost was associated with the hospital stay length. The cost of the entire treatment including antibiotics was $359 196.16 USD; based on the simulation of early microbiological culture, the model results showed cost could be reduced by 10% to 25% (in this study, the cost could be as low as $304 624.63 USD). The use of early microbiological cultures on IDFU to determine the appropriate antibiotic can reduce treatment costs by >30% if hospital stay is part of the consideration.
Asunto(s)
Costo de Enfermedad , Técnicas de Cultivo/economía , Úlcera del Pie/economía , Factores de Tiempo , Adulto , Anciano , Técnicas de Cultivo/métodos , Técnicas de Cultivo/estadística & datos numéricos , Diabetes Mellitus Tipo 2/complicaciones , Diabetes Mellitus Tipo 2/economía , Diabetes Mellitus Tipo 2/terapia , Pie Diabético/economía , Pie Diabético/terapia , Femenino , Úlcera del Pie/terapia , Hospitales Públicos/organización & administración , Hospitales Públicos/estadística & datos numéricos , Humanos , Estudios Longitudinales , Masculino , México , Persona de Mediana Edad , Modelos Estadísticos , Estudios ProspectivosRESUMEN
El suicidio es un problema de salud pública mundial y los adolescentes son los que presentan con mayor frecuencia esta problemática. El estudio realizado identifica la estructura semántica del dominio cultural, el promedio de conocimiento y el grado de consenso cultural que sobre el suicidio tienen adolescentes con tentativa suicida. El trabajo es un estudio cualitativo mediante la técnica de listas libres. Participaron 29 adolescentes (13 a 18 años). Las listas libres fueron sobre: las causas; los signos y los síntomas; lo que siente, piensa y hace un adolescente antes de cometer suicidio y las estrategias de prevención de éste. Los resultados muestran para cada pregunta un único modelo semántico en el dominio cultural. En lo estructural se identifican los problemas familiares como la causa del intento suicida; la depresión y la tristeza son síntomas previos al intento suicida. La tristeza y la soledad, salir del problema y suicidarse es lo que considera que siente, piensa y hace un adolescente previo al intento de suicidio. Como estrategias de prevención, se identifican le ponga más atención y hablar con él. Los resultados ponderan la importancia de la familia para los programas de prevención de las conductas suicidas en adolescentes.
The suicide is a problem of public world health and the adolescents are those who present with more frequency this problem. Nevertheless, the studies of the suicide phenomenon from a cultural perspective are limited. Cultural research in suicidology is important to develop the understanding of the meanings of suicidal behavior in different contexts. The cultural consensus theory would contribute to the cultural perspective of the knowledge of suicidal behaviors in terms of its internal elements and their functioning (emic) and this theory allows knowing if there exists a knowledge shared by a social group regarding an issue and allows to recognize its organization. The aim of this study was to identify the semantic structure of the cultural domain, as well as the average of knowledge and the degree of cultural consensus regarding suicide among adolescent suicide attempters. It was a qualitative study, using the free-listing technique, with a non-random sample made up of 29 adolescents between the ages of 13 and 18 years. The free lists were on: the causes; the signs and the symptoms; what he/she feels, thinks and does before attempting suicide and the strategies of suicide prevention at adolescence. The results showed for every question a single semantic model in the cultural domain suicide attempt. In such structure, the family problems were identified as the cause of suicidal attempt; the depression and the sadness were symptoms before suicidal attempt. The sadness, the loneliness and the angerwere what an adolescent feels before the suicide attempt. Furthermore, to get out of the problem and to end his/her life were what an adolescent thinks before attempting suicide and to commit suicide was what an adolescent does before to suicide attempt. To pay more attention, to talk with the adolescent, to improve the communication with the parents and to attend a psychotherapy were identified as strategies for suicide prevention. The results highlight the importance of the family of suicide prevention programs for adolescents based on cultural knowledge.
RESUMEN
INTRODUCTION: Adipose tissue is an important estrogen resource and they are involved in breast cancer development. OBJECTIVE: To establish the relationship between adiposity percentage and the estrogen and progesterone receptors immunoreactive score in Mexican women with breast cancer. METHODS: This is a transversal and analytical study. We identified breast cancer women with cancer histologic diagnosis. We calculated: adiposity percentage and immunoreactive score. We performed correlation analysis between adiposity percentage, body mass index, diabetes mellitus and arterial hypertension, with estrogen and progesterone receptors in breast cancer samples. We perform logistic regression and Odds Ratio estimations. RESULTS: We studied 43 patients with breast cancer and we observed association between adiposity percentage and estrogen and progesterone immnunoreactive score (rP 0.470; p 0.003 and rP 0.328; p 0.042, respectively). The most important risk factor in breast cancer positive to estrogen receptors was obesity (OR 19.1, IC95% 2.1 a 169.1, p 0.008), and previous obesity in breast cancer positive to progesterone receptors (OR 20.7, IC95% 2.3 a 185.9, p 0.007). DISCUSSION: Adiposity percentage is an important risk factor to develop breast cancer positive to hormone receptors related with the risk of breast cancer positive to hormonal receptors (AU)
Introducción: El tejido adiposo es una importante fuente de estrógenos, los cuales se encuentran implicados en el desarrollo de cáncer de mama. Objetivo: Establecer la relación entre el porcentaje de adiposidad y el índice de inmunorreactividad de los receptores a estrógenos y a progesterona en mujeres mexicanas con cáncer de mama. Métodos: Estudio transversal analítico en pacientes con cáncer de mama confirmado con estudio histopatológico. Se estimó el % de adiposidad, y el índice de inmunorreactividad. Se realizó el análisis de correlación entre el porcentaje de adiposidad, el IMC, la presencia de DM2 e hipertensión arterial con la expresión de receptores a estrógeno y progesterona y regresión logística con cálculo de Odds Ratio. Resultados: Se estudiaron 43 pacientes con cáncer de mama y se observó asociación entre el porcentaje de adiposidad y el índice de inmunoreactividad para los RE y RP (rP 0,470; p 0,003 y rP 0,328; p 0,042 respectivamente). El factor de riesgo más importante en cáncer positivo a receptores estrogénicos fue la obesidad (OR 19,1, IC 95% 2,1 a 169,1, p 0,008) y obesidad previa en cáncer positivo a receptores a progesterona (OR 20,7, IC 95% 2,3 a 185,9, p 0,007). Conclusión: El porcentaje de adiposidad es un factor de riesgo importante para desarrollar cáncer de mama positivo a receptores hormonales (AU)
Asunto(s)
Humanos , Femenino , Adiposidad/fisiología , Neoplasias de la Mama/complicaciones , Receptores de Estrógenos/inmunología , Obesidad/complicaciones , Factores de Riesgo , Receptores de Progesterona/inmunologíaRESUMEN
INTRODUCTION: Adipose tissue is an important estrogen resource and they are involved in breast cancer development. OBJECTIVE: To establish the relationship between adiposity percentage and the estrogen and progesterone receptors immunoreactive score in Mexican women with breast cancer. METHODS: This is a transversal and analytical study. We identified breast cancer women with cancer histologic diagnosis. We calculated: adiposity percentage and immunoreactive score. We performed correlation analysis between adiposity percentage, body mass index, diabetes mellitus and arterial hypertension, with estrogen and progesterone receptors in breast cancer samples. We perform logistic regression and Odds Ratio estimations. RESULTS: We studied 43 patients with breast cancer and we observed association between adiposity percentage and estrogen and progesterone immnunoreactive score (rP 0.470; p 0.003 and rP 0.328; p 0.042, respectively). The most important risk factor in breast cancer positive to estrogen receptors was obesity (OR 19.1, IC95% 2.1 a 169.1, p 0.008), and previous obesity in breast cancer positive to progesterone receptors (OR 20.7, IC95% 2.3 a 185.9, p 0.007). DISCUSSION: Adiposity percentage is an important risk factor to develop breast cancer positive to hormone receptors related with the risk of breast cancer positive to hormonal receptors.
Introducción: El tejido adiposo es una importante fuente de estrógenos, los cuales se encuentran implicados en el desarrollo de cáncer de mama. Objetivo: Establecer la relación entre el porcentaje de adiposidad y el índice de inmunorreactividad de los receptores a estrógenos y a progesterona en mujeres mexicanas con cáncer de mama. Métodos: Estudio transversal analítico en pacientes con cáncer de mama confirmado con estudio histopatológico. Se estimó el % de adiposidad, y el índice de inmunorreactividad. Se realizó el análisis de correlación entre el porcentaje de adiposidad, el IMC, la presencia de DM2 e hipertensión arterial con la expresión de receptores a estrógeno y progesterona y regresión logística con cálculo de Odds Ratio. Resultados: Se estudiaron 43 pacientes con cáncer de mama y se observó asociación entre el porcentaje de adiposidad y el índice de inmunoreactividad para los RE y RP (rP 0,470; p 0,003 y rP 0,328; p 0,042 respectivamente). El factor de riesgo más importante en cáncer positivo a receptores estrogénicos fue la obesidad (OR 19,1, IC 95% 2,1 a 169,1, p 0,008) y obesidad previa en cáncer positivo a receptores a progesterona (OR 20,7, IC 95% 2,3 a 185,9, p 0,007). Conclusión: El porcentaje de adiposidad es un factor de riesgo importante para desarrollar cáncer de mama positivo a receptores hormonales.
Asunto(s)
Adiposidad/fisiología , Neoplasias de la Mama/metabolismo , Receptores de Estrógenos/inmunología , Receptores de Progesterona/inmunología , Adulto , Anciano , Composición Corporal/fisiología , Femenino , Humanos , Inmunohistoquímica , Modelos Logísticos , México/epidemiología , Persona de Mediana Edad , Oportunidad Relativa , Receptores de Estrógenos/metabolismo , Receptores de Progesterona/metabolismo , Factores de RiesgoRESUMEN
BACKGROUND: Incisional pain is the main obstacle for elective laparoscopic cholecystectomy as an outpatient. We evaluated the analgesic efficacy of local infiltration of ropivacaine with dexamethasone (Rop/Dx), compared with ropivacaine (Rop) alone, during the first 24 hours postoperative of this surgery. Our hypothesis is that incisional pain intensity will be lower in patients of the group Rop/Dx. METHODS: In a randomized, controlled, double-blind trial clinical, 80 patients were divided into two groups. Group Rop (n= 40) received pre and post-incisional infiltration with 150 mg of ropivacaine in 8 mL of 0.9% saline, while group Rop/Dx (n= 40) received 150 mg of ropivacaine with 8 mg of dexamethasone in 6 mL of 0.9% saline. The intensity of pain at rest and movement was assessed at 2, 4, 8, 12 and 24 hours postoperatively by a numerical rating scale of 11 points. RESULTS: Incisional pain scores in group Rop/Dx were significantly lower, compared to the group Rop, at 12 hours (p= 0.05) and 24 hours (p= 0.01) at rest and at 12 hours (p= 0.04) and 24 hours (p= 0.01) during movement postoperatively. CONCLUSIONS: We found initial evidence that ropivacaine with dexamethasone for local infiltration decreased incisional pain intensity after 12 hours post-elective laparoscopic cholecystectomy with a good safety profile.
Antecedentes: el dolor incisional es el principal obstáculo para la colecistectomía laparoscópica electiva ambulatoria. Objetivo: evaluar la eficacia analgésica de la infiltración local de ropivacaína con dexametasona (Rop/Dx) en comparación con ropivacaína (Rop) sola, durante las primeras 24 horas del postoperatorio de esta cirugía. Material y métodos: ensayo clínico aleatorizado, controlado y doble ciego, efectuado en 80 pacientes que para fines de estudio se dividieron en dos grupos. El grupo Rop (n= 40) recibió infiltración pre y post-incisional con 150 mg de ropivacaína en 8 mL de solución salina 0.9%, mientras que el grupo Rop/Dx (n= 40) recibió 150 mg de ropivacaína con 8 mg de dexametasona en 6 mL de solución salina 0.9%. La intensidad del dolor durante el reposo y el movimiento se evaluó a las 2, 4, 8, 12 y 24 horas del postoperatorio con una escala de clasificación numérica de 11 puntos. La hipótesis es que la intensidad del dolor incisional será menor en los pacientes del grupo Rop/Dx. Resultados: las puntuaciones del dolor incisional en el grupo Rop/Dx fueron significativamente menores, comparadas con el grupo Rop, a las 12 horas (p= 0.05) y 24 horas (p= 0.01) durante el reposo y a las 12 horas (p= 0.04) y 24 horas (p= 0.01) durante el movimiento postoperatorio. Conclusiones: la evidencia inicial es que la ropivacaína con dexametasona, por infiltración local, disminuye la intensidad del dolor incisional a partir de las 12 horas post-colecistectomía laparoscópica electiva con un buen perfil de seguridad.
Asunto(s)
Amidas/uso terapéutico , Anestésicos Locales/uso terapéutico , Colecistectomía Laparoscópica/efectos adversos , Dexametasona/uso terapéutico , Dolor Postoperatorio/prevención & control , Adulto , Amidas/administración & dosificación , Anestésicos Locales/administración & dosificación , Dexametasona/administración & dosificación , Método Doble Ciego , Quimioterapia Combinada , Procedimientos Quirúrgicos Electivos , Femenino , Humanos , Instilación de Medicamentos , Masculino , Persona de Mediana Edad , Dimensión del Dolor , Dolor Postoperatorio/tratamiento farmacológico , Dolor Postoperatorio/etiología , Descanso , RopivacaínaRESUMEN
Objetivo: Determinar la prevalencia del síndrome de desgaste profesional (burnout) en odontólogos del sector educativo y privado. Material y métodos: Estudio observacional, descriptivo y transversal, mediante el censo del personal odontológico de la Zona Metropolitana de Guadalajara, México de la Universidad de Guadalajara y los que ejercen la práctica privada, donde participaron 135 de ellos aplicándoseles una ficha de identificación y elMaslach Burnout Inventory-Human Services Survey en forma auto-administrada. Las estadísticas descriptivas y el análisis inferencial se realizaron con apoyo del SPSS 15.0 y Epi-infoV6.1. Resultados: Se logró el 90,0 % de respuesta. Se detectó una frecuencia del síndrome de desgaste profesional(burnout) en el 50,3 % de ellos. Se obtuvieron diferencias significativas en función a ser menor de 40 años de edad. Se observó la correlación negativa entre las subescalas agotamiento emocional y despersonalización y positiva entre la falta de realización personal en el trabajo. Conclusiones: El síndrome de desgaste profesional (burnout) es frecuente (50,3 %) en los odontólogos, sus principales factores de riesgo: laborar en la práctica privada, el ser mujer, menor de 40 años de edad, sin pareja estable y con más de 15 años con pareja, el no trabajar la pareja, sin hijos, ser especialista, con menos de 10 años de antigüedad laboral y en el puesto actual de trabajo más de 10 años, laborar en el turno matutino, contratación definitiva y el tener otro trabajo. La afectación del agotamiento emocional y la despersonalización se comporta como el síndrome. Los niveles medios de las subescalas se encuentran en general cerca de la normalidad. Se encontró una correlación negativa entre las subescalas agotamiento emocional y despersonalización y positiva entre la falta de realización personal en el trabajo con la presencia del síndrome. Es necesario establecer medidas preventivas o de intervención en los niveles individual, social u organizacional para reducir la prevalencia encontrada (AU)
Objective: To determine the prevalence of burnout (burnout) in dental education and private sector. Material and methods: Methods: Observational, descriptive and cross through the dental staff census metropolitan area of Guadalajara, Mexico at the University of Guadalajara and those in private practice, attended by 135 of the mapplying to the maform of identification and the Maslach Burnout Inventory-Human Services Survey in a self-administered. Descriptive statistics and inferential analyzes were performed using SPSS15.0 support and Epi-infoV6.1. Results: We achieved 90.0 % response. Was detected a frequency of burnout (burnout) in 50.3 % of them. There were significant differences in function to be under 40 years of age. Negative correlation was observed between emotional exhaustion and depersonalization subscales and positive relationship between lacks of personal accomplishment at work. Conclusions: The syndrome of burnout (burnout) is frequent (50.3 %) for dentists, the main risk factors: work in private practice, being female, under 40 years old without regular partner and with more than 15 years with partner, partner not working, no children, be a specialist, with less than 10 years of work and the current job more than 10 years work in the morning shift, permanent recruitment and have other work. Involvement of the emotional exhaustion and depersonalization behaves like syndrome. The average levels of the subscales are generally near normal. We found a negative correlation between emotional exhaustion and depersonalization subscales and positive relationship between lacks of personal fulfillment in working with the presence of the syndrome. It is necessary to establish preventive or intervention at the individual, social or organizational to reduce the prevalence found (AU)
Asunto(s)
Humanos , Masculino , Femenino , Adulto Joven , Adulto , Odontólogos/psicología , Agotamiento Profesional/epidemiología , Odontólogos/estadística & datos numéricos , Despersonalización/epidemiología , Satisfacción en el Trabajo , México/epidemiología , Epidemiología Descriptiva , Estudios TransversalesRESUMEN
BACKGROUND: When blood pressure (BP) is taken for the first time, it should be measured in both arms; follow-up measurements should be taken in the arm with the highest BP. However, in clinical practice, this recommendation is rarely followed. OBJECTIVE: Identify the degree of differences in BP between the right and the left arm in individuals with normal and high BP. METHODS: We measured BP in 111 hypertensive and 80 normotensive patients in both arms at the same time using identical Omron HEM 725 CIC automatic sphygmomanometers. The devices were then switched to the other arm and another set of readings was taken. The absolute and relative difference in BP between arms was calculated from the average of these two readings. We categorized differences as at least 5, at least 10, and at least 20 mmHg for systolic blood pressure/diastolic blood pressure (SBP/DBP). RESULTS: The BP was higher in the right arm, with no statistical significance. The relative differences were also not significant: SBP 1.1±7.1 and DBP 0.21±5.0. However, the absolute differences were significant at an individual level, with a systolic difference of 5.4±4.8 mmHg and a diastolic difference of 3.9 ±3.2 mmHg. The percentages of absolute SBP/DBP differences more than 5 mmHg (21.4%/20.4%) and more than 10 mmHg (15.7%/4.7%) were considerable. The range of arm differences was clinically significant; in hypertensives, the SBP/DBP was -13.2 to +15/-9.2 to +9.6 mmHg and in nonhypertensives it was -12.9 to +15.6/-9.7 to +10.1 mmHg. CONCLUSION: Although on average there was no clinically significant relative difference between arms, absolute differences at an individual level were often clinically significant. Failure to determine interarm BP differences will lead to erroneous clinical decisions.
Asunto(s)
Brazo/fisiopatología , Determinación de la Presión Sanguínea/métodos , Presión Sanguínea , Hipertensión/diagnóstico , Esfigmomanometros , Adulto , Anciano , Anciano de 80 o más Años , Brazo/fisiología , Determinación de la Presión Sanguínea/instrumentación , Femenino , Humanos , Hipertensión/fisiopatología , Masculino , Persona de Mediana Edad , Adulto JovenRESUMEN
BACKGROUND: In medical anthropology, culture is shared knowledge and it can be used to study cultural consensus for development of preventive and control actions in chronic diseases such as high blood pressure. The aim of this study was to characterize the semantic structure and level of cultural consensus regarding the causes of arterial hypertension in persons >15 years of age belonging to families of laborers from "Colonia Fabrica de Atemajac." METHODS: Using a propositive sample of 36 persons >15 year of age of both genders and divided into three age groups, we conducted an anthropological study. A structured questionnaire and semi-structured interviews were applied in order to obtain the semantic model and cultural consensus regarding the causes of arterial hypertension. RESULTS: The semantic structure of the model links the causes of arterial hypertension to emotions and certain risk conditions that vary in relation to their arrangement as elements of related semantics nuclei according to age group. CONCLUSIONS: Our results show evidence of one semantic model in regard to the causes of arterial hypertension and different from the biomedical cognitive pattern. These types of models must be taken into account for establishing cultural comprehensive health policies.
Asunto(s)
Conocimientos, Actitudes y Práctica en Salud , Hipertensión/etiología , Adolescente , Adulto , Femenino , Humanos , Masculino , México , Persona de Mediana Edad , Modelos Teóricos , Semántica , Adulto JovenRESUMEN
Este estudio buscó identificar la estructura semántica del dominio cultural, el promedio de conocimiento y el grado de consenso cultural manifestado por los adolescentes sobre el intento de suicidio. Fue un estudio cualitativo de listas libres, con un muestreo propositivo no aleatorizado de 27 adolescentes entre 13 y 18 años. Los resultados evidenciaron un solo modelo semántico. En lo estructural se identificó el problema familiar como una causa importante del intento suicida; las categorías depresión y tristeza se consideraron como signos y síntomas previos a esta tentativa y no como causas. Como estrategias de prevención, se consideró recibir información mediante pláticas o establecer conversaciones sobre los problemas. Este modelo permite proponer estrategias de prevención que privilegien el núcleo familiar.
The objective of this study was to identify the semantic structure of the cultural domain, as well as the average knowledge and degree of cultural consensus among adolescents regarding suicide attempts. It was a qualitative study, using the free-listing technique, with a non-random sample made up of 27 adolescents between the ages of 13 and 18. The results showed a single semantic model. in such structure, family problems were identified as an important cause of suicide attempts, while depression and sadness were identified as signs and symptoms prior to the attempt, rather than as causes. Information talks and conversations about problems were suggested as prevention strategies. This model makes it possible to propose prevention strategies that prioritize the family nucleus.
Este estudo buscou identificar a estrutura semântica do domínio cultural, o nível de conhecimento e o grau de consenso cultural manifestado pelos adolescentes acerca da tentativa de suicídio. Foi um estudo qualitativo com listas livres e uma amostra propositiva, não aleatória, com 27 adolescentes entre 13 e 18 anos. Os resultados evidenciaram somente um modelo semântico. No estrutural identificou-se o problema familiar como uma causa importante para as tentativas de suicídio; enquanto que as categorias depressão e tristeza foram consideradas não como causas, mas como signos e sintomas prévios a esta tentativa. Como estratégias de prevenção foram consideradas a recepção da informação mediante diálogos livres ou mediante conversações sobre os problemas. Esse modelo permite propor estratégias de prevenção que privilegiem o núcleo familiar.
Asunto(s)
Adolescente , Intento de Suicidio/prevención & control , Intento de Suicidio/psicología , Suicidio/prevención & control , Suicidio/psicología , Salud Mental , Núcleo Familiar/psicologíaRESUMEN
Objectives: To develop and to evaluate a questionnaire of self-perception and self-care habits on oral health on afirst level population.Methods: A descriptive, observational study was performed to validate a questionnaire on oral health self-perception(UISESS-B). After non-probabilistic sampling, 94 users, 30-59 years of age, with either diabetes mellitus 2,hypertension or obesity were included. Duration of disease was lesser than 10 years. Pearsons r, Cornbachs á,factorial analysis, chi-square and Snedecors F tests were employed.Results: A Pearsons r of 0.7 and Cronbachs á of 0.82 was observed on the pre-post values of the global question-naire. In the factorial analysis, the variance explained more than 60% for a first factor. A punctuation of very highrisk for the three groups with the scale UISESSS-B that coincides with the index CPO-D and the index UISESS-Fwas observed.Conclusions: The UISESS-B scale shows significant validity and reliability, sugg esting its use as a sensitive instrumentfor the measurement of oral health in people with chronic illnesses such as diabetes, hypertension andobesity (AU)
No disponible
Asunto(s)
Humanos , Obesidad/complicaciones , Diabetes Mellitus Tipo 2/complicaciones , Hipertensión/complicaciones , Salud Bucal , Índice de Higiene Oral , Autoimagen , HábitosRESUMEN
BACKGROUND: We undertook this study to determine the effectiveness of triple treatment associated with Lactobacillus casei strain Shirota against Helicobacter pylori, in comparison with triple conventional treatment without Lactobacillus. METHODS: We designed a clinical comparative randomized study that included patients of both sexes infected by Helicobacter pylori. Patients were studied with endoscopy, biopsy and serology. Control group received traditional triple treatment with clarithromycin, amoxicillin and omeprazole, and the active group received the same treatment plus Lactobacillus casei strain Shirota. With the breath test at 8 weeks we determined the eradication of Helicobacter pylori. RESULTS: In the active group we included 31 patients. After treatment, in 29 persons (94%) it was possible to eradicate the Helicobacter pylori. On the other hand, the control group was comprised of 33 patients who received only the traditional triple treatment; eradication was achieved in 25 patients (76%). Significant differences (p<0.05) were observed in favor of active group treatment. CONCLUSIONS: Traditional triple treatment plus Lactobacillus casei strain Shirota is associated with a higher frequency of eradication of Helicobacter pylori than triple treatment alone.
Asunto(s)
Antibacterianos/uso terapéutico , Infecciones por Helicobacter/terapia , Helicobacter pylori , Lacticaseibacillus casei , Adulto , Anciano , Terapia Combinada , Quimioterapia Combinada , Femenino , Humanos , Masculino , Persona de Mediana EdadRESUMEN
BACKGROUND/AIMS: Identify hepatitis C virus (HCV) sequences in E1 and E2 protein binding to HepG2. METHODS: Synthetic 20-mer long, ten-residue overlapped peptides, from E1 and E2 proteins, were tested in HepG2 or Raji cell-binding assays. Affinity constants, binding site number per cell and Hill coefficients were determined by saturation assay for high activity binding peptides (HABPs). Receptors for HepG2 cell were determined by cross-linking and sodium dodecyl sulfate-polyacrylamide gel electrophoresis analysis. RESULTS: Twelve HABPs were found in HCV genotype 1a, allowing six hepatocyte-binding sequences (HBSs) to be defined: two peptide-binding regions in E1 HABPs 4913 (YQVRNSTGLYHVTNDCPNSS) and 4918 (MTPTVATRDGKLPATQLRRHY). Four hepatocyte-binding regions were defined in E2: region-I, peptide 4931 (ETHVTGGSAGHTVSGFVSLLY); region-II, 4937-4939 (HHKFNSSGCPERLASCRPLTDFDQGWGPISYANGSGPDQR); region-III, 4943-4945 (PVYCFTPSPVVVGTTDRSGAPTYSWGENDTDVFVLNNTR) and region-IV, 4949-4952 (CGAPPCVIGGAGNNTLHCPTDCFRKHPDATYSRCGSGPWITPRCLVDYPY). The underlined sequences are most relevant in the binding process. HABPs 4913 and 4938 also bind to CD81 positive Raji cells. Region-II 4938 HABPs bind to 50 and 60kDa HepG2 cell membrane surface proteins. CONCLUSIONS: Six HVRs to the HepG2 were identified. Some HABPs have been previously found to be antigenic and immunogenic. HABPs, 4918 (from E1), 4938, 4949, 4950, 4951 and 4952 (from E2) have not been previously recognised. These HABPs could be relevant to HCV invasion of hepatocytes.
Asunto(s)
Hepacivirus/genética , Hepatitis C/virología , Proteínas del Envoltorio Viral/genética , Proteínas Virales/genética , Secuencia de Aminoácidos , Genotipo , Humanos , Radioisótopos de Yodo , Neoplasias Hepáticas , Datos de Secuencia Molecular , Unión Proteica/genética , Células Tumorales Cultivadas/metabolismo , Células Tumorales Cultivadas/virología , Proteínas del Envoltorio Viral/metabolismo , Proteínas Virales/metabolismoRESUMEN
Se construyó una tabla de vida para la población usuaria del Instituo Mexicano del Seguro Social, Delegación Jalisco, con el fin de conocer la esperanza de vida (EV) en esa población, sus diferencias en cuanto a grupo etáreo, sexo y variaciones de tendencia. Fue utilizado el método abreviado de Reed y Merrel, con datos obtenidos de los certificados de defunción de 1996. Se calculó una EV al nacer de 76.36 años para hombres y 79.7 para mujeres, cifras superiores a la nacional (70.8 años) y a la de Jalisco (72.17 años). Es notable una mejoría en la EV general, hay un cambio positivo de 3.31 puntos respecto al año de 1983. Concluimos que nuestra población está al borde de una transición demográfica consumada, con un incremento del grupo de 20 a 64 años, y que se requiere adoptar los servicios a la nueva estructura de salud poblacional. Por ello, el equipo de salud deberá estrechar su labor participativa con la población, teniendo a la seguridad social como base de la promoción y cuidado de la salud