Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 652
Filtrar
1.
J Med Virol ; 96(7): e29774, 2024 Jul.
Artículo en Inglés | MEDLINE | ID: mdl-38953434

RESUMEN

Factor VIII and IX clotting factor concentrates manufactured from pooled plasma have been identified as potent sources of virus infection in persons with hemophilia (PWHs) in the 1970s and 1980s. To investigate the range and diversity of viruses over this period, we analysed 24 clotting factor concentrates for several blood-borne viruses. Nucleic acid was extracted from 14 commercially produced clotting factors and 10 from nonremunerated donors, preserved in lyophilized form (expiry dates: 1974-1992). Clotting factors were tested by commercial and in-house quantitative PCRs for blood-borne viruses hepatitis A, B, C and E viruses (HAV, HBV, HCV, HEV), HIV- types 1/2, parvoviruses B19V and PARV4, and human pegiviruses types 1 and 2 (HPgV-1,-2). HCV and HPgV-1 were the most frequently detected viruses (both 14/24 tested) primarily in commercial clotting factors, with frequently extremely high viral loads in the late 1970s-1985 and a diverse range of HCV genotypes. Detection frequencies sharply declined following introduction of virus inactivation. HIV-1, HBV, and HAV were less frequently detected (3/24, 1/24, and 1/24 respectively); none were positive for HEV. Contrastingly, B19V and PARV4 were detected throughout the study period, even after introduction of dry heat treatment, consistent with ongoing documented transmission to PWHs into the early 1990s. While hemophilia treatment is now largely based on recombinant factor VIII/IX in the UK and elsewhere, the comprehensive screen of historical plasma-derived clotting factors reveals extensive exposure of PWHs to blood-borne viruses throughout 1970s-early 1990s, and the epidemiological and manufacturing parameters that influenced clotting factor contamination.


Asunto(s)
Factores de Coagulación Sanguínea , Patógenos Transmitidos por la Sangre , Humanos , Patógenos Transmitidos por la Sangre/aislamiento & purificación , Infecciones de Transmisión Sanguínea/epidemiología , Infecciones de Transmisión Sanguínea/virología , Contaminación de Medicamentos , Historia del Siglo XX , Hemofilia A , Virus/clasificación , Virus/aislamiento & purificación , Virus/genética , Reacción en Cadena de la Polimerasa , Factor VIII , Factores de Tiempo
2.
Cureus ; 16(6): e62125, 2024 Jun.
Artículo en Inglés | MEDLINE | ID: mdl-38993456

RESUMEN

Drug reaction with eosinophilia and systemic symptoms (DRESS) is a severe and rare syndrome that causes life-threatening organ dysfunctions. Here, we present the case of a 10-year-old child who developed a pruritic erythematous eruption, fever, facial edema, and lymphadenopathy seven days after receiving intravenous metronidazole (20 mg/kg/day), vancomycin (50 mg/kg/day), and cefotaxime (200 mg/kg/day). Laboratory tests showed eosinophilia and liver damage as well as positive parvovirus B19 IgM and IgG indicating viral reactivation. Vancomycin was initially discontinued and later reintroduced with no ill effects. The patient was managed with topical corticosteroid emollients and cetirizine and improved within seven days of metronidazole withdrawal. Treatment with cefotaxime was continued and showed no adverse effects.

3.
Protein J ; 2024 Jul 09.
Artículo en Inglés | MEDLINE | ID: mdl-38980534

RESUMEN

Spectroscopic studies on domains and peptides of large proteins are complicated because of the tendency of short peptides to form oligomers in aquatic buffers, but conjugation of a peptide with a carrier protein may be helpful. In this study we approved that a fragment of SK30 peptide from phospholipase A2 domain of VP1 Parvovirus B19 capsid protein (residues: 144-159; 164; 171-183; sequence: SAVDSAARIHDFRYSQLAKLGINPYTHWTVADEELLKNIK) turns from random coil to alpha helix in the acidic medium only in case if it had been conjugated with BSA (through additional N-terminal Cys residue, turning it into CSK31 peptide, and SMCC linker) according to CD-spectroscopy results. In contrast, unconjugated SK30 peptide does not undergo such shift because it forms stable oligomers connected by intermolecular antiparallel beta sheet, according to IR-spectroscopy, CD-spectroscopy, blue native gel electrophoresis and centrifugal ultrafiltration, as, probably, the whole isolated phospholipase domain of VP1 protein does. However, being a part of the long VP1 capsid protein, phospholipase domain may change its fold during the acidification of the medium in the endolysosome by the way of the formation of contacts between protonated His153 and Asp175, promoting the shift from random coil to alpha helix in its N-terminal part. This study opens up a perspective of vaccine development, since rabbit polyclonal antibodies against the conjugate of CSK31 peptide with BSA, in which the structure of the second alpha helix from the phospholipase A2 domain should be reproduced, can bind epitopes of the complete recombinant unique part of VP1 Parvovirus B19 capsid (residues: 1-227).

5.
Euro Surveill ; 29(25)2024 Jun.
Artículo en Inglés | MEDLINE | ID: mdl-38904112

RESUMEN

From April 2023 to May 2024, an unusual epidemic of parvovirus B19 (B19V) infections occurred in France. The number of B19V IgM-positive serologies was four times higher than in the previous epidemic in 2019. Clinical data from emergency networks corroborated this observation. Morbidity and mortality consequences were observed in children through all data sources. In adults, the increase was only observed in laboratory-confirmed data. Physicians and decisionmakers should be informed in order to better prevent, diagnose and manage at-risk patients.


Asunto(s)
Brotes de Enfermedades , Inmunoglobulina M , Infecciones por Parvoviridae , Parvovirus B19 Humano , Humanos , Francia/epidemiología , Parvovirus B19 Humano/aislamiento & purificación , Adulto , Femenino , Masculino , Niño , Infecciones por Parvoviridae/epidemiología , Infecciones por Parvoviridae/diagnóstico , Inmunoglobulina M/sangre , Adolescente , Preescolar , Persona de Mediana Edad , Anticuerpos Antivirales/sangre , Eritema Infeccioso/epidemiología , Eritema Infeccioso/diagnóstico , Adulto Joven , Lactante , Anciano
6.
Biomol NMR Assign ; 2024 Jun 21.
Artículo en Inglés | MEDLINE | ID: mdl-38904726

RESUMEN

Parvovirus B19 (B19V) is a human pathogen that is the causative agent of several diseases in infants and adults. Due to a lack of antivirals against this virus, treatment options are limited. The minor capsid protein of B19V has a unique N terminus, named VP1u, which is essential for infection. The VP1u encodes a receptor binding domain (RBD), necessary for host cell entry, and a phospholipase A2 (PLA2) domain, crucial for endosomal escape during cellular trafficking. Both domains are indispensable for infection, making the RBD a plausible drug target for inhibitors against B19V, as it is located on the exterior surface of the virus. To date, no experimental structural information has been available for the VP1u component for any Parvovirus. Here we report the backbone NMR resonance assignments for the RBD of B19V and demonstrate it forms a stable structure. The backbone chemical shifts are in good agreement with a structure predicted by AlphaFold, validating that the RBD contains three helices connected by tight turns. This RBD construct can now be used for further NMR studies, including assignment of full-length VP1u, determination of protein-protein interaction interfaces, and development of B19 antivirals specific to the RBD domain.

7.
Cureus ; 16(5): e60937, 2024 May.
Artículo en Inglés | MEDLINE | ID: mdl-38915956

RESUMEN

Splenic sequestration crisis is a life-threatening complication of sickle cell disease (SCD), characterized by a sudden and huge accumulation of blood in the spleen, leading to rapid enlargement and may lead to organ failure. This case report discusses an unusual case of a splenic sequestration crisis in an adult with SCD. The patient's age, Parvovirus B19 infection, and concurrent retrocardiac pneumonia are all things that differentiate this case from our usual presentation. We will be discussing the clinical presentation, diagnostic methods, and management.

8.
Euro Surveill ; 29(24)2024 Jun.
Artículo en Inglés | MEDLINE | ID: mdl-38873795

RESUMEN

We report an epidemic of parvovirus B19 infections in Denmark during the first quarter of 2024, with a peak incidence 3.5 times higher than during the most recent epidemic in 2017. In total, 20.1% (130/648) of laboratory-confirmed cases were pregnant. Severe adverse outcomes were observed among 12.3% (16/130) of pregnant people and included foetal anaemia, foetal hydrops and miscarriage. Parvovirus B19 infection is not systematically monitored, but a national laboratory-based surveillance system is currently being established in Denmark.


Asunto(s)
Infecciones por Parvoviridae , Parvovirus B19 Humano , Complicaciones Infecciosas del Embarazo , Humanos , Femenino , Embarazo , Dinamarca/epidemiología , Parvovirus B19 Humano/aislamiento & purificación , Complicaciones Infecciosas del Embarazo/epidemiología , Complicaciones Infecciosas del Embarazo/diagnóstico , Complicaciones Infecciosas del Embarazo/virología , Adulto , Incidencia , Infecciones por Parvoviridae/epidemiología , Infecciones por Parvoviridae/diagnóstico , Epidemias , Hidropesía Fetal/epidemiología , Hidropesía Fetal/virología , Índice de Severidad de la Enfermedad , Adulto Joven , Eritema Infeccioso/epidemiología , Eritema Infeccioso/diagnóstico , Adolescente , Aborto Espontáneo/epidemiología , Aborto Espontáneo/virología , Vigilancia de la Población
9.
Res Sq ; 2024 Jun 04.
Artículo en Inglés | MEDLINE | ID: mdl-38883784

RESUMEN

Parvovirus B19 (B19V) is a human pathogen that is the causative agent of several diseases in infants and adults. Due to a lack of antivirals against this virus, treatment options are limited. The minor capsid protein of B19V has a unique N terminus, named VP1u, which is essential for infection. The VP1u encodes a receptor binding domain (RBD), necessary for host cell entry, and a phospholipase A2 (PLA2) domain, crucial for endosomal escape during cellular trafficking. Both domains are indispensable for infection, making the RBD a plausible drug target for inhibitors against B19V, as it is located on the exterior surface of the virus. To date, no experimental structural information has been available for the VP1u component for any Parvovirus. Here we report the backbone NMR resonance assignments for the RBD of B19V and demonstrate it forms a stable structure. The backbone chemical shifts are in good agreement with a structure predicted by AlphaFold, validating that the RBD contains three helices connected by tight turns. This RBD construct can now be used for further NMR studies, including assignment of full-length VP1u, determination of protein-protein interaction interfaces, and development of B19 antivirals specific to the RBD domain. Database: BMRB submission code: 52440.

10.
Virol J ; 21(1): 108, 2024 05 10.
Artículo en Inglés | MEDLINE | ID: mdl-38730285

RESUMEN

BACKGROUND: The immature and suppressed immune response makes transplanted children a special susceptible group to Parvovirus B19 (PVB19). However, the clinical features of transplanted children with PVB19 infection haven't been comprehensively described. METHODS: We searched the medical records of all the transplant recipients who attended the Children's Hospital of Fudan University from 1 Oct 2020 to 31 May 2023, and reviewed the medical literature for PVB19 infection cases among transplanted children. RESULTS: A total of 10 cases of PVB19 infection were identified in 201 transplanted children at our hospital, and the medical records of each of these cases were shown. Also, we retrieved 40 cases of PVB19 infection among transplanted children from the literature, thus summarizing a total of 50 unique cases of PVB19 infection. The median time to the first positive PVB19 DNA detection was 14 weeks post-transplantation. PVB19 IgM and IgG were detected in merely 26% and 24% of the children, respectively. The incidence of graft loss/dysfunction was as high as 36%. Hematopoietic stem cell transplant (HSCT) recipients showed higher PVB19 load, lower HGB level, greater platelet damage, lower PVB19 IgM/IgG positive rates, and more graft dysfunction than solid-organ transplant (SOT) recipients, indicating a more incompetent immune system. CONCLUSIONS: Compared with the published data of transplanted adults, transplanted children displayed distinct clinical features upon PVB19 infection, including lower PVB19 IgM/IgG positive rates, more graft dysfunction, and broader damage on hematopoietic cell lines, which was even more prominent in HSCT recipients, thus should be of greater concern.


Asunto(s)
Anticuerpos Antivirales , Trasplante de Células Madre Hematopoyéticas , Infecciones por Parvoviridae , Parvovirus B19 Humano , Humanos , Parvovirus B19 Humano/inmunología , Parvovirus B19 Humano/genética , Niño , Femenino , Masculino , Preescolar , Infecciones por Parvoviridae/virología , Infecciones por Parvoviridae/inmunología , Trasplante de Células Madre Hematopoyéticas/efectos adversos , Anticuerpos Antivirales/sangre , Lactante , Adolescente , Inmunoglobulina M/sangre , Inmunoglobulina G/sangre , Receptores de Trasplantes , ADN Viral/sangre , Carga Viral , Trasplante de Órganos/efectos adversos
11.
Pediatr Nephrol ; 2024 May 22.
Artículo en Inglés | MEDLINE | ID: mdl-38775967

RESUMEN

A 13-year-old girl who had a kidney transplant four weeks prior presented with a 10-day history of fatigue, paleness, and headache. On physical examination, tachycardia and paleness were noted. Laboratory testing was notable for severe anemia and mild leukopenia and thrombocytopenia. Polymerase chain reaction (PCR) test for Epstein-Barr virus (EBV) and cytomegalovirus (CMV) were negative and for parvovirus B19 (PVB19) was positive. Despite lower immunosuppression and administration of intravenous immunoglobulin (IVIG) it persisted for 15 months, and frequent red blood cell transfusions were needed. PVB19 is a less common but significant complication. The patient's clinical course demonstrates the importance of this complication and the challenges in its management. A notable void exists in the literature regarding standardized treatment protocols for PVB19-induced recurrent anemia after kidney transplant. This case indicates the need for further research and consensus to guide effective clinical interventions in similar cases.

12.
Euro Surveill ; 29(21)2024 May.
Artículo en Inglés | MEDLINE | ID: mdl-38785091

RESUMEN

In France, blood donations are tested in pools of 96 samples for parvovirus B19 (B19V) DNA to discard plasma for fractionation when it contains high viral loads. Between January 2015 and March 2024, B19V-positive donations decreased during the COVID-19 pandemic, followed by a strong rebound in 2023 and unusually high circulation during winter 2023/24 (ca 10 times higher December 2023-March 2024 vs the pre-pandemic period). Variations over time are probably related to measures implemented to limit SARS-CoV-2 spread.


Asunto(s)
Donantes de Sangre , Infecciones por Parvoviridae , Parvovirus B19 Humano , Humanos , Donación de Sangre , Donantes de Sangre/estadística & datos numéricos , COVID-19/epidemiología , ADN Viral/sangre , Francia/epidemiología , Tamizaje Masivo , Pandemias , Infecciones por Parvoviridae/sangre , Infecciones por Parvoviridae/epidemiología , Parvovirus B19 Humano/aislamiento & purificación , Estaciones del Año , Carga Viral
13.
Diagn Microbiol Infect Dis ; 109(4): 116300, 2024 Aug.
Artículo en Inglés | MEDLINE | ID: mdl-38759541

RESUMEN

BACKGROUND: Parvovirus B19(B19) is a DNA virus. The most common B19 disease is erythema infectiosum (fifth-disease). PCR and ELISA are sensitive for detecting of acute disease. However, it is not clear which test better and the relationship between laboratory tests and clinical findings. OBJECTIVE: To discuss the clinical and laboratory characteristics of pediatric patients infected with B19. STUDY DESIGN: 236 children were examined. Children with at least one positive molecular or serological test were included. Positive serum B19-DNA and/or B19-IgM was considered an acute B19 infection. RESULTS: B19DNA was detected in 80.8 % of acute cases. Serological tests were less positive. Acute B19 infection was observed in 24 patients. Only 17 patients were positive for B19 DNA, 3 for IgM and 4 for both. The sensitivity of B19 DNA is 87.5 %. However, this rate is 29.2 % for B19 IgM. CONCLUSION: B19-DNA and IgM together provide a better, highly accurate diagnosis.


Asunto(s)
Anticuerpos Antivirales , ADN Viral , Eritema Infeccioso , Inmunoglobulina M , Parvovirus B19 Humano , Humanos , Parvovirus B19 Humano/genética , Parvovirus B19 Humano/inmunología , Parvovirus B19 Humano/aislamiento & purificación , Niño , Inmunoglobulina M/sangre , Preescolar , Femenino , Masculino , ADN Viral/sangre , Anticuerpos Antivirales/sangre , Eritema Infeccioso/diagnóstico , Eritema Infeccioso/sangre , Eritema Infeccioso/inmunología , Lactante , Sensibilidad y Especificidad , Adolescente , Reacción en Cadena de la Polimerasa/métodos , Infecciones por Parvoviridae/diagnóstico , Infecciones por Parvoviridae/sangre , Infecciones por Parvoviridae/inmunología , Infecciones por Parvoviridae/virología , Ensayo de Inmunoadsorción Enzimática , Pruebas Serológicas/métodos
14.
Int J Infect Dis ; 144: 107043, 2024 Jul.
Artículo en Inglés | MEDLINE | ID: mdl-38583826

RESUMEN

This is a case report of a 6-year-old girl with relapsed B cell acute lymphoblastic leukemia in which adoptive cell therapy was applied successfully to treat refractory human parvovirus (HPV) B19 infection. Allogenic chimeric antigen receptor (CAR) T-cell therapy (bispecific CD19/CD22) was bridged to hematopoietic stem cell transplantation (HSCT) using a haploidentical paternal donor. However, HPV B19 DNAemia progressed and transfusion-related graft versus host disease occurred. After finding a third-party related donor with a better HLA match, haploidentical HPV B19-seropositive CD45RA+ depleted cells (16.5 × 106/kg) were administered and paternal TCRαß+ depleted stem cell were retransplanted. The HPV B19 DNAemia became negative within 1 week and the reticulocyte, neutrophil, hemoglobin, and platelet counts gradually normalized. The patient remained stable during the 1-year outpatient follow-up period. Thus, our case report highlights that persistent B19 infection can lead to pancytopenia, aplastic crisis, and graft rejection and TCRαß+ depleted haplo-HSCT is an effective means of hematopoiesis recovery. CD45RO memory T-cell therapy is the key to treating and preventing the development of refractory severe HPV B19 infection.


Asunto(s)
Trasplante de Células Madre Hematopoyéticas , Infecciones por Parvoviridae , Parvovirus B19 Humano , Receptores de Antígenos de Linfocitos T alfa-beta , Humanos , Femenino , Niño , Parvovirus B19 Humano/inmunología , Infecciones por Parvoviridae/terapia , Infecciones por Parvoviridae/inmunología , Antígenos Comunes de Leucocito/metabolismo , Inmunoterapia Adoptiva/métodos , Anemia Aplásica/terapia , Anemia Aplásica/inmunología , Enfermedad Injerto contra Huésped/terapia , Enfermedad Injerto contra Huésped/inmunología , Resultado del Tratamiento , Leucemia-Linfoma Linfoblástico de Células Precursoras B/terapia , Leucemia-Linfoma Linfoblástico de Células Precursoras B/inmunología
15.
Viral Immunol ; 37(4): 177-185, 2024 05.
Artículo en Inglés | MEDLINE | ID: mdl-38625025

RESUMEN

Viral infections are major causes of mortality in solid-organ and hematopoietic stem cell transplant recipients. Epstein-Barr virus (EBV) and Parvovirus B19 (B19V) are among the common viral infections after transplantation and were recommended for increased screening in relevant guidelines. Therefore, the development of rapid, specific, and cost-effective diagnostic methods for EBV and B19V is of paramount importance. We applied Fluorescence of Loop Primer Upon Self-Dequenching Loop-mediated Isothermal Amplification (FLOS-LAMP) for the first time to develop a novel multiplex assay for the detection of EBV and B19V; the fluorophore attached to the probe are self-quenched in unbound state. After binding to the dumbbell-shaped DNA target, the fluorophore is dequenched, resulting in fluorescence development. The novel multiplex FLOS-LAMP assay was optimized by testing various ratios of primer sets. This novel assay, with great specificity, did not cross-react with the common virus. For the detection of EBV and B19V, the limits of detection could reach 969 and 798 copies/µL, respectively, and the assay could be completed within 25 min. Applying this novel assay to detect 200 clinical transplant individuals indicated that the novel assay had high specificity and good sensitivity. We developed multiplex FLOS-LAMP assay for the detection of EBV and B19V, which has the potential to become an important tool for clinical transplant patient screening.


Asunto(s)
Infecciones por Virus de Epstein-Barr , Herpesvirus Humano 4 , Técnicas de Diagnóstico Molecular , Técnicas de Amplificación de Ácido Nucleico , Parvovirus B19 Humano , Sensibilidad y Especificidad , Humanos , Herpesvirus Humano 4/genética , Herpesvirus Humano 4/aislamiento & purificación , Técnicas de Amplificación de Ácido Nucleico/métodos , Parvovirus B19 Humano/genética , Parvovirus B19 Humano/aislamiento & purificación , Infecciones por Virus de Epstein-Barr/diagnóstico , Infecciones por Virus de Epstein-Barr/virología , Técnicas de Diagnóstico Molecular/métodos , Fluorescencia , Cartilla de ADN/genética , Receptores de Trasplantes , Infecciones por Parvoviridae/diagnóstico , Infecciones por Parvoviridae/virología , ADN Viral/genética , Trasplante de Órganos
16.
Vox Sang ; 119(6): 624-629, 2024 Jun.
Artículo en Inglés | MEDLINE | ID: mdl-38482941

RESUMEN

BACKGROUND AND OBJECTIVES: In Canada, plasma sent for fractionation is tested for both parvovirus B19 (B19V) and hepatitis A virus (HAV). This study compared positivity rates of B19 and HAV nucleic acid tests (NATs) in Canadian plasma samples for the pre-COVID-19 restriction era (2015 to end of February 2020 [Q1] 2020) and the post-COVID-19 restriction era. MATERIALS AND METHODS: Pooled EDTA plasma specimens were tested within 24 months of blood draw using the Procleix Panther System (Grifols Diagnostic Solutions Inc, San Diego, CA, USA) for B19V and HAV detection. Reactive pools were resolved by individual specimen testing. RESULTS: Between 1 January 2015, and 31 March 2022, 3,928,619 specimens from Canadian plasma donors were tested for B19V. For the same period, 3,922,954 specimens were tested for HAV. To account for a lag in specimen testing for up to 24 months, the data were divided into: (1) a pre-pandemic period (1 January 2015-31 March 2020; B19V tested n = 2,412,701, B19V NAT-positive n = 240 [0.01%], HAV tested n = 2,407,036, HAV NAT-positive n = 26 [0.001%]); (2) a two-year mixed-impact period (1 April 2020-31 March 2022; B19V tested n = 968,250, B19V NAT-positive n = 14 [0.001%], HAV tested n = 968,250, HAV NAT-positive n = 2 [0.0002%]); and (3) a pandemic-impact period (1 April 2022-31 March, 2023; B19V tested n = 597,668, B19V NAT-positive n = 3 [0.0005%], HAV tested n = 597,668, HAV NAT-positive n = 1 [0.0002%]). CONCLUSION: The percentage of B19V- and HAV-positive donations was significantly reduced from the pre-pandemic period to the pandemic-impact period.


Asunto(s)
Donantes de Sangre , COVID-19 , Parvovirus B19 Humano , Humanos , COVID-19/sangre , COVID-19/epidemiología , Canadá/epidemiología , Hepatitis A/sangre , Hepatitis A/epidemiología , SARS-CoV-2 , Masculino , Femenino , Virus de la Hepatitis A , Infecciones por Parvoviridae/sangre , Infecciones por Parvoviridae/epidemiología
17.
J Pers Med ; 14(2)2024 Jan 26.
Artículo en Inglés | MEDLINE | ID: mdl-38392573

RESUMEN

Parvovirus B19, a member of the Parvoviridae family, is a human pathogenic virus. It can be transmitted by respiratory secretions, hand-to-mouth contact, blood transfusion, or transplacental transmission. Most patients are asymptomatic or present with mild symptoms such as erythema infectiosum, especially in children. In rare cases, moderate-to-severe symptoms may occur, affecting blood cells and other systems, resulting in anemia, thrombocytopenia, and neutropenia. Non-immune pregnant women are at risk for fetal infection by parvovirus B19, with greater complications if transmission occurs in the first or second trimester. Infected fetuses may not show any abnormalities in most cases, but in more severe cases, there may be severe fetal anemia, hydrops, and even pregnancy loss. Maternal diagnosis of intrauterine parvovirus B19 infection includes IgG and IgM antibody testing. For fetal diagnosis, PCR is performed through amniocentesis. In addition to diagnosing the infection, it is important to monitor the peak of systolic velocity of the middle cerebral artery (PVS-MCA) Doppler to assess the presence of fetal anemia. There is no vaccine for parvovirus B19, and fetal management focuses on detecting moderate/severe anemia by fetal PVS-MCA Doppler, which, if diagnosed, should be treated with intrauterine transfusion by cordocentesis. Prevention focuses on reducing exposure in high-risk populations, particularly pregnant women.

18.
Arch Virol ; 169(3): 52, 2024 Feb 20.
Artículo en Inglés | MEDLINE | ID: mdl-38378929

RESUMEN

Parvoviruses are responsible for multiple diseases, and there is a critical need for effective antiviral therapies. Specific antiviral treatments for parvovirus infections are currently lacking, and the available options are mostly supportive and symptomatic. In recent years, significant research efforts have been directed toward understanding the molecular mechanisms of parvovirus replication and identifying potential targets for antiviral interventions. This review highlights the structure, pathogenesis, and treatment options for major viruses of the subfamily Parvovirinae, such as parvovirus B19 (B19V), canine parvovirus type 2 (CPV-2), and porcine parvovirus (PPV) and also describes different approaches in the development of antiviral alternatives against parvovirus, including drug repurposing, serendipity, and computational tools (molecular docking and artificial intelligence) in drug discovery. These advances greatly increase the likelihood of discoveries that will lead to potent antiviral strategies against different parvovirus infections.


Asunto(s)
Infecciones por Parvoviridae , Parvovirinae , Parvovirus B19 Humano , Parvovirus , Animales , Porcinos , Antivirales/farmacología , Antivirales/uso terapéutico , Inteligencia Artificial , Simulación del Acoplamiento Molecular , Infecciones por Parvoviridae/tratamiento farmacológico
19.
Qatar Med J ; 2024(1): 8, 2024.
Artículo en Inglés | MEDLINE | ID: mdl-38344403

RESUMEN

Anemia in kidney transplant recipients can stem from a diverse array of etiologies, including dietary deficiencies, inflammatory processes, allograft dysfunction, as well as viral and bacterial infections. We present a case of refractory anemia in a 49-year-old male patient occurring within the initial month following a kidney transplant, which persisted despite numerous transfusions, posing a formidable challenge. The patient was maintained on the standard immunosuppressant regimen-Tacrolimus, Mycophenolate, and Prednisolone. Diagnostic evaluations eliminated well-established causes such as dietary deficiencies, gastrointestinal losses, and prevalent infections. Subsequently, after viral PCR testing, a diagnosis of Pure Red Cell Aplasia (PRCA) due to infection with parvovirus B19 was made. Although the patient had a reduction in the immunosuppression drugs and received a course of Intravenous Immunoglobulins (IVIG) on two separate occasions spanning two months, the anemia relapsed. Subsequently, after an additional dose of IVIG with further modification and reduction of the immunosuppressant regimen, including stopping the mycophenolate and switching tacrolimus with cyclosporine, the patient ultimately achieved successful resolution of his symptoms and a significant decrease in viral load. Our case highlights the significance of unconventional etiologies when confronted with anemia in the setting of kidney transplantation. Furthermore, it also provides further insights into therapeutic avenues for addressing PRCA in kidney transplant recipients.

20.
Intern Med ; 2024 Feb 19.
Artículo en Inglés | MEDLINE | ID: mdl-38369359

RESUMEN

Parvovirus B19 infection can cause chronic pure red cell aplasia in immunosuppressed hosts or acute and transient aplastic crises in immunocompetent hosts. In dialysis patients, only transient aplastic crisis induced by parvovirus B19 infection has been reported. We herein report the first case of an adult dialysis patient who developed chronic pure red cell aplasia associated with parvovirus B19 infection. Repeated pneumonia and heart failure may contribute to an immunocompromised status, making the patient more vulnerable to parvovirus B19 infection. This case expands on the differential diagnosis of chronic anemia in patients undergoing dialysis.

SELECCIÓN DE REFERENCIAS
DETALLE DE LA BÚSQUEDA