Your browser doesn't support javascript.
loading
Show: 20 | 50 | 100
Resultados 1 - 20 de 72
Filtrar
1.
Ann Intern Med ; 176(7): 922-933, 2023 07.
Artículo en Inglés | MEDLINE | ID: mdl-37335994

RESUMEN

BACKGROUND: An effective and safe treatment for nausea and vomiting of pregnancy (NVP) is lacking. OBJECTIVE: To assess the efficacy and safety of acupuncture, doxylamine-pyridoxine, and a combination of both in women with moderate to severe NVP. DESIGN: Multicenter, randomized, double-blind, placebo-controlled, 2 × 2 factorial trial. (ClinicalTrials.gov: NCT04401384). SETTING: 13 tertiary hospitals in mainland China from 21 June 2020 to 2 February 2022. PARTICIPANTS: 352 women in early pregnancy with moderate to severe NVP. INTERVENTION: Participants received daily active or sham acupuncture for 30 minutes and doxylamine-pyridoxine or placebo for 14 days. MEASUREMENTS: The primary outcome was the reduction in Pregnancy-Unique Quantification of Emesis (PUQE) score at the end of the intervention at day 15 relative to baseline. Secondary outcomes included quality of life, adverse events, and maternal and perinatal complications. RESULTS: No significant interaction was detected between the interventions (P = 0.69). Participants receiving acupuncture (mean difference [MD], -0.7 [95% CI, -1.3 to -0.1]), doxylamine-pyridoxine (MD, -1.0 [CI, -1.6 to -0.4]), and the combination of both (MD, -1.6 [CI, -2.2 to -0.9]) had a larger reduction in PUQE score over the treatment course than their respective control groups (sham acupuncture, placebo, and sham acupuncture plus placebo). Compared with placebo, a higher risk for births with children who were small for gestational age was observed with doxylamine-pyridoxine (odds ratio, 3.8 [CI, 1.0 to 14.1]). LIMITATION: The placebo effects of the interventions and natural regression of the disease were not evaluated. CONCLUSION: Both acupuncture and doxylamine-pyridoxine alone are efficacious for moderate and severe NVP. However, the clinical importance of this effect is uncertain because of its modest magnitude. The combination of acupuncture and doxylamine-pyridoxine may yield a potentially larger benefit than each treatment alone. PRIMARY FUNDING SOURCE: The National Key R&D Program of China and the Project of Heilongjiang Province "TouYan" Innovation Team.


Asunto(s)
Terapia por Acupuntura , Antieméticos , Complicaciones del Embarazo , Embarazo , Niño , Femenino , Humanos , Doxilamina/efectos adversos , Piridoxina/uso terapéutico , Piridoxina/efectos adversos , Antieméticos/uso terapéutico , Calidad de Vida , Vómitos/tratamiento farmacológico , Vómitos/inducido químicamente , Náusea/tratamiento farmacológico , Complicaciones del Embarazo/tratamiento farmacológico , Terapia por Acupuntura/efectos adversos
2.
Environ Monit Assess ; 195(3): 407, 2023 Feb 16.
Artículo en Inglés | MEDLINE | ID: mdl-36795252

RESUMEN

As an important indicator of the regional thermal environment, land surface temperature (LST) is closely related to community health and regional sustainability in general, and is influenced by multiple factors. Previous studies have paid scant attention to spatial heterogeneity in the relative contribution of factors underlying LST. In this study of Zhejiang Province, we investigated the key factors affecting daytime and nighttime annual mean LST and the spatial distribution of their respective contributions. The eXtreme Gradient Boosting tree (XGBoost) and Shapley Additive exPlanations algorithm (SHAP) approach were used in combination with three sampling strategies (Province-Urban Agglomeration -Gradients within Urban Agglomeration) to detect spatial variation. The results reveal heterogenous LST spatial distribution with lower LST in the southwestern mountainous region and higher temperatures in the urban center. Spatially explicit SHAP maps indicate that latitude and longitude (geographical locations) are the most important factors at the provincial level. In urban agglomerations, factors associated with elevation and nightlight are shown to positively impact daytime LST in lower altitude regions. In the urban centers, EVI and MNDWI are the most notable influencing factors on LST at night. Under different sampling strategies, EVI, MNDWI, NL, and NDBI affect LST more prominently at smaller spatial scales as compared to AOD, latitude and TOP. The SHAP method proposed in this paper offers a useful means for management authorities in addressing LST in a warming climate.


Asunto(s)
Monitoreo del Ambiente , Calor , Temperatura , Monitoreo del Ambiente/métodos , Clima , Árboles
3.
Liver Int ; 42(10): 2167-2174, 2022 10.
Artículo en Inglés | MEDLINE | ID: mdl-35758891

RESUMEN

BACKGROUND AND AIMS: In vitro fertilization-embryo transfer (IVF-ET) may increase the risk of mother-to-child transmission (MTCT) of hepatitis B virus (HBV). The purpose of this study was to investigate the impact and safety of IVF-ET on MTCT in women with chronic HBV infection (CHB). METHODS: The data of 298 women who got pregnant by IVF-ET and their 375 children were collected retrospectively. Mothers were divided into the CHB group (n = 224) and the control group (HBsAg negative, n = 74). After birth, newborns were routinely vaccinated with the hepatitis B vaccine, and infants in the CHB group were injected with hepatitis B immunoglobulin within 2 h after birth. Demographic information, clinical data and laboratory test results were collected. The primary outcome measures were the MTCT rate of HBV, and the secondary outcome measures were the safety of the mother and infant. RESULTS: There was no case of HBV MTCT in all 282 newborns born in the CHB group and 93 neonates born in the control group. Of the two groups, the birth weight (3056.74 ± 601.65 vs. 2926.24 ± 704.86, P = .083), length (49.22 ± 1.97 vs. 48.74 ± 3.09, P = .167), 5-min Apgar score (9.97 ± 0.21 vs. 9.90 ± 0.51, P = .212), days of pregnancy (265.70 ± 12.73 vs. 262.02 ± 17.50, P = .064) and neonatal malformation rate (0.71% vs. 0, P = 1.000) were similar. Two cases of neonatal malformation occurred in the CHB group. The incidences of pregnancy and childbirth complications were similar between the two groups. CONCLUSION: IVF-ET does not increase the risk of MTCT in women with chronic HBV infection, and it is safe for mothers and infants.


Asunto(s)
Hepatitis B Crónica , Hepatitis B , Complicaciones Infecciosas del Embarazo , ADN Viral , Transferencia de Embrión , Femenino , Fertilización In Vitro , Hepatitis B/prevención & control , Antígenos de Superficie de la Hepatitis B , Vacunas contra Hepatitis B , Virus de la Hepatitis B/genética , Humanos , Lactante , Recién Nacido , Transmisión Vertical de Enfermedad Infecciosa/prevención & control , Madres , Embarazo , Estudios Retrospectivos
4.
Clin Gastroenterol Hepatol ; 19(5): 1061-1063, 2021 05.
Artículo en Inglés | MEDLINE | ID: mdl-32371166

RESUMEN

Hepatitis B virus (HBV) infection is a global health issue. Mother-to-child transmission (MTCT) is the most prominent route for chronic HBV infection in Asian countries.1 Although standard immunoprophylaxis has been effective in preventing MTCT, a significantly higher rate of MTCT has been observed among mothers with high levels of viremia.2 Tenofovir disoproxil, telbivudine (LdT), and lamivudine, used in third trimester, have been shown to significantly reduce MTCT of HBV for highly viremic mothers.3 Although the efficacy and short-term safety of LdT in preventing MTCT have been demonstrated in several large cohort studies in recent years, fewer data exist on the safety assessment of infants' neurocognitive development after fetal exposure to LdT.4-6 Therefore, we conducted a prospective cohort study to investigate the effect of LdT on infants' neurocognitive development.


Asunto(s)
Hepatitis B Crónica , Complicaciones Infecciosas del Embarazo , Antivirales/efectos adversos , ADN Viral , Femenino , Virus de la Hepatitis B , Hepatitis B Crónica/tratamiento farmacológico , Humanos , Lactante , Transmisión Vertical de Enfermedad Infecciosa , Embarazo , Complicaciones Infecciosas del Embarazo/tratamiento farmacológico , Tercer Trimestre del Embarazo , Estudios Prospectivos , Telbivudina/uso terapéutico
5.
Exp Appl Acarol ; 83(4): 583-596, 2021 Apr.
Artículo en Inglés | MEDLINE | ID: mdl-33709252

RESUMEN

Ticks are obligate blood-sucking parasitic arthropods. When sucking the blood of hosts, they can also transmit a variety of pathogens to hosts that severely endanger the health of humans and animals. The spermatheca is an organ for the storage and protection of sperm and an important component of the reproductive system of female ticks. The spermatheca content changes dramatically over time after copulation. In particular, some proteins and polypeptide substances can influence the physiological functions of female ticks and promote blood feeding and egg laying by female ticks. To investigate the molecular mechanisms underlying the productive process of Haemaphysalis longicornis, data-independent acquisition (DIA) quantitative proteomics technology was used to perform in-depth research of the dynamic changes in all proteins in the spermatheca of ticks within a short time after copulation to look for key proteins in the spermatheca contents after copulation that affect the reproduction of female ticks in order to provide meaningful information for the comprehensive prevention and control of ticks.


Asunto(s)
Ixodidae , Garrapatas , Animales , Copulación , Femenino , Proteómica , Reproducción
6.
Int J Med Sci ; 17(2): 170-175, 2020.
Artículo en Inglés | MEDLINE | ID: mdl-32038100

RESUMEN

Background: The aim of this study was to describe biochemical, virological features and Mother-to child-transmission (MTCT) rate in chronic hepatitis B (CHB) women who stopped antiviral therapy before or in the early pregnancy. Methods: This was a single-center, retrospective study. Forty-three CHB women who stopped treatment before or in the early pregnancy and 103 CHB women with tenofovir disoproxil fumarate (TDF) treatment throughout pregnancy were enrolled. The virological and biochemical flares during pregnancy and postpartum period were studied. MTCT rates were also compared. Results: During pregnancy, ALT flares (43.9% vs 1.0%) and viral rebound (31.7% vs 0) were more common in women who stopped treatment (P<0.001). Postpartum ALT flares were less frequent in women with treatment than those stopped treatment (0 vs 6/35, P = 0.001). The birth defect rate in the mothers who stopped treatment did not statistically differ from that of mothers treated throughout pregnancy (4.9 % vs 3.9 %, P = 1.000). There were no significant differences of gestational complications between the two groups, except intrahepatic cholestasis of pregnancy (12.2% vs 0, P = 0.002). The rate of MTCT in mothers who discontinued treatment was higher (2.4% vs 0, P = 0.285), although there was no statistically significant. Conclusion: ALT flares were common in mothers who discontinued antiviral therapy. Thus, these pregnant women should be monitored closely. Cessation of treatment was not recommended although no hepatic failure was observed. Larger studies are needed to evaluate the safety of discontinuation before pregnancy.


Asunto(s)
Hepatitis B Crónica/tratamiento farmacológico , Complicaciones Infecciosas del Embarazo/tratamiento farmacológico , Resultado del Embarazo , Tenofovir/efectos adversos , Adulto , ADN Viral/genética , ADN Viral/aislamiento & purificación , Femenino , Antígenos e de la Hepatitis B , Virus de la Hepatitis B/efectos de los fármacos , Virus de la Hepatitis B/patogenicidad , Hepatitis B Crónica/complicaciones , Hepatitis B Crónica/transmisión , Hepatitis B Crónica/virología , Humanos , Transmisión Vertical de Enfermedad Infecciosa , Periodo Posparto/fisiología , Embarazo , Complicaciones Infecciosas del Embarazo/patología , Complicaciones Infecciosas del Embarazo/virología , Tenofovir/uso terapéutico , Carga Viral/genética
7.
J Med Internet Res ; 22(5): e15977, 2020 05 25.
Artículo en Inglés | MEDLINE | ID: mdl-32449685

RESUMEN

BACKGROUND: The disproportionately high prevalence of HIV among men who have sex with men (MSM) is a global concern. Despite the increasing utilization of electronic health (eHealth) technology in the delivery of HIV prevention interventions, few studies have systematically explored its effectiveness and association with various intervention characteristics. OBJECTIVE: This study aimed to conduct a meta-analysis of the effectiveness of eHealth technology-based interventions for promoting HIV-preventive behaviors among MSM and to determine effectiveness predictors within a framework integrating design and implementation features. METHODS: A systematic literature search using terms related to eHealth technology, HIV, the MSM population, and an experimental study design was performed using 5 databases (ie, MEDLINE, PsycINFO, EMBASE, Web of Science, and ProQuest Dissertations & Theses) and other sources (eg, bibliographies of relevant reviews and JMIR Publications). First, primary meta-analyses were conducted to estimate the effectiveness of eHealth interventions (d+) in changing 3 HIV-preventive behaviors among MSM: unprotected anal intercourse (UAI), HIV testing, and multiple sex partnership (MSP). Moderation analyses were then conducted to examine a priori effectiveness predictors including behavioral treatment components (eg, theory use, tailoring strategy use, navigation style, and treatment duration), eHealth technology components (eg, operation mode and modality type), and intervention adherence. RESULTS: A total of 46 studies were included. The overall effect sizes at end point were small but significant for all outcomes (UAI: d+=-.21, P<.001; HIV testing: d+=.38, P<.001; MSP: d+=-.26, P=.02). The intervention effects on UAI were significantly larger when compared with preintervention groups than with concurrent groups. Greater UAI reductions were associated with the increased use of tailoring strategies, provision of feedback, and tunneling navigation in interventions with a concurrent group, whereas reductions were associated with the use of self-paced navigation in interventions with a preintervention group. Greater uptake of HIV testing was associated with longer treatment duration; computer-mediated communication; and the use of messaging, social media, or a combined technology modality. Higher intervention adherence consistently predicted larger effects on UAI and HIV testing. CONCLUSIONS: This study provided empirical evidence for the effectiveness of eHealth interventions in promoting HIV-preventive behaviors among MSM. Features of treatment content and eHealth technology might best predict the intervention effects on UAI and HIV testing, respectively. Most importantly, intervention adherence tended to play an important role in achieving better effectiveness. The findings could help inform the development of efficacious interventions for HIV prevention in the future.


Asunto(s)
Electrónica Médica/métodos , Infecciones por VIH/prevención & control , Homosexualidad Masculina/estadística & datos numéricos , Humanos , Masculino
8.
Chem Biodivers ; 17(11): e2000503, 2020 Nov.
Artículo en Inglés | MEDLINE | ID: mdl-32940397

RESUMEN

A systematically chemical investigation of Citrus changshan-huyou Y.B.Chang resulted in the isolation and structure determination of twelve known natural products, including limonoid, nootkatone, scoparone, ß-sitosterol, 3,3',4',5,6,7,8,-heptamethoxyflavone, nobiletin, tangeretin, naringin, hesperidin, neohesperidin, 3,5-dihydroxyphenyl ß-D-glucoside, ß-sitosterol-D-glucoside. The structure modification of the most abundant compound limonin further led to eight limonoid derivatives, including epi-limonol, epi-limonyl acetate, and six new compounds epi-limonol A, limonol A, limonol B, epi-limonol B, epi-limonol C, epi-limonol D, which enlarged the chemical diversity of limonin related limonoids. The structures of the new limonoid derivatives were identified by extensive spectroscopic analysis. In bioassay, all the isolates, the semi-synthetic derivatives and the previously isolated limonoids in our natural product library were subjected for anti-inflammatory activities evaluation, and several limonoids exhibited the inhibition of TNF-α release.


Asunto(s)
Antiinflamatorios/química , Citrus/química , Animales , Antiinflamatorios/aislamiento & purificación , Antiinflamatorios/farmacología , Citrus/metabolismo , Frutas/química , Frutas/metabolismo , Limoninas/química , Limoninas/aislamiento & purificación , Limoninas/farmacología , Lipopolisacáridos/farmacología , Macrófagos/citología , Macrófagos/efectos de los fármacos , Macrófagos/metabolismo , Espectroscopía de Resonancia Magnética , Medicina Tradicional China , Ratones , Conformación Molecular , Extractos Vegetales/química , Células RAW 264.7 , Relación Estructura-Actividad , Factor de Necrosis Tumoral alfa/metabolismo
9.
Exp Appl Acarol ; 80(2): 289-309, 2020 Feb.
Artículo en Inglés | MEDLINE | ID: mdl-31919614

RESUMEN

Haemaphysalis longicornis is an ixodid tick that can spread a wide variety of pathogens, affecting humans, livestock and wildlife health. The high reproductive capability of this species is initiated by the ingestion of a large amount of blood ingested by the engorged female tick. The degree of ovarian development is proportional to the number of eggs laid. Studying the regulatory mechanism of tick ovary development is relevant for the development of novel tick control methods. In this study, we used quantitative proteomics to study the dynamic changes in protein expression and protein phosphorylation during ovarian development of engorged female H. longicornis ticks. Synergistic action of many proteins (n = 3031) is required to achieve ovarian development and oocyte formation rapidly. Through bioinformatics analysis, changes in protein expressions and phosphorylation modifications in regulating the ovarian development of female ticks are described. Many proteins play an essential role during ovarian development. Also, protein phosphorylation appeared an important reproductive strategy to enable ticks to efficiently convert large amounts of blood in the ovaries into egg-producing components and ultimately produce many eggs.


Asunto(s)
Ixodidae/crecimiento & desarrollo , Ovario/crecimiento & desarrollo , Proteómica , Animales , Femenino
10.
Korean J Parasitol ; 58(2): 161-171, 2020 Apr.
Artículo en Inglés | MEDLINE | ID: mdl-32418385

RESUMEN

The ticks feed large amount of blood from their hosts and transmit pathogens to the victims. The salivary gland plays an important role in the blood feeding. When the female ticks are near engorgement, the salivary gland gradually loses its functions and begins to rapidly degenerate. In this study, data-independent acquisition quantitative proteomics was used to study changes in the phosphorylation modification of proteins during salivary gland degeneration in Haemaphysalis longicornis. In this quantitative study, 400 phosphorylated proteins and 850 phosphorylation modification sites were identified. Trough RNA interference experiments, we found that among the proteins with changes in phosphorylation, apoptosis-promoting Hippo protein played a role in salivary gland degeneration.


Asunto(s)
Proteínas de Artrópodos/metabolismo , Regeneración , Glándulas Salivales/fisiología , Animales , Apoptosis , Proteínas de Drosophila , Femenino , Péptidos y Proteínas de Señalización Intracelular , Fosforilación , Proteínas Serina-Treonina Quinasas
11.
Inorg Chem ; 58(8): 4722-4730, 2019 Apr 15.
Artículo en Inglés | MEDLINE | ID: mdl-30299930

RESUMEN

A chiral ionic liquid (CIL) moiety of a l-pyrrolidin-2-ylimidazole-decorated homochiral UiO-68-type metal-organic framework, UiO-68-CIL (1), was successfully prepared by the combination of a new premodified chiral CIL ligand (H2L-CIL) and ZrCl4 via a solvothermal method. The TiO2-loaded TiO2@UiO-68-CIL (2) was prepared by impregnating 1 in a toluene solution of Ti(OPri)4 and sequential in situ hydrolysis. The obtained 2 can be a bifunctional asymmetric heterogeneous catalyst to successfully promote the one-pot Morita-Baylis-Hillman reaction starting from aromatic alcohols in a tandem way.

12.
Am J Gastroenterol ; 113(5): 686-693, 2018 05.
Artículo en Inglés | MEDLINE | ID: mdl-29487412

RESUMEN

INTRODUCTION: We aimed to characterize postpartum disease flares among treatment-naive mothers with chronic hepatitis B (CHB). CHB mothers were enrolled and compared with non-infected mothers in terms of postpartum alanine aminotransferase (ALT) abnormalities. METHODS: Demographic, virological, and biochemical parameters were collected up to postpartum week 16, with flares and exacerbations defined as ALT levels 5-10 and >10 times the upper limit of normal, respectively. Outcome assessments included ALT flares or exacerbation and their predictive parameters. RESULTS: Among 4236 patients enrolled, 869 and 3367 had no infection (group A) and had CHB (group B), respectively. Infected mothers were further stratified into two subgroups by the presence (B1, n = 1928) or absence (B2, n = 1439) of detectable serum levels of hepatitis B virus (HBV) DNA (lowest level of quantitation, 100 IU/mL). A significantly higher frequency of abnormal ALT levels was observed in group B vs. group A (28.27 vs. 20.37%, p < 0.001). ALT events mainly occurred in group B1 (flares, 115/1928, 5.96%; exacerbations, 57/1928, 2.96%). The ALT levels had a bimodal pattern, with peaks at postpartum weeks 3-4 and 9-12. On multivariate analysis, elevated ALT levels and detectable levels of HBV DNA at delivery were independent risk factors for postpartum disease flares. Further subgroup analysis in group B1 demonstrated that a cut-off HBV DNA level of 5 log10 IU/mL at delivery predicted ALT events (positive predictive value, 14.4%; negative predictive value, 98.2%). CONCLUSIONS: Postpartum ALT level elevation is common in CHB patients. ALT flares or exacerbations are mainly observed in mothers with elevated ALT or HBV DNA levels ≥5 log10 IU/mL at delivery.


Asunto(s)
Alanina Transaminasa/sangre , Hepatitis B Crónica/patología , Trastornos Puerperales/patología , Brote de los Síntomas , Adulto , Estudios de Casos y Controles , China , ADN Viral/sangre , ADN Viral/aislamiento & purificación , Progresión de la Enfermedad , Femenino , Virus de la Hepatitis B/genética , Virus de la Hepatitis B/aislamiento & purificación , Hepatitis B Crónica/sangre , Hepatitis B Crónica/diagnóstico , Hepatitis B Crónica/virología , Humanos , Pruebas de Función Hepática , Periodo Posparto , Valor Predictivo de las Pruebas , Pronóstico , Trastornos Puerperales/sangre , Trastornos Puerperales/diagnóstico , Trastornos Puerperales/virología
13.
Int J Clin Oncol ; 23(2): 321-328, 2018 Apr.
Artículo en Inglés | MEDLINE | ID: mdl-29101499

RESUMEN

BACKGROUND: Cervical cancer is one of the most common malignant tumours of the female reproductive system, ranking second only to breast cancer in morbidity worldwide. Essential features of the progression of cervical cancer are invasion and metastasis, which are closely related to disease prognosis and mortality rate. At the present time there is no effective method to evaluate cancer invasion and metastasis before surgery. Here we report our study on molecular changes in biopsy tissue for the prognostic evaluation of cancer invasion and metastasis. PATIENTS AND METHODS: Expression of the epithelial-mesenchymal transition-inducing transcription factors Twist1 and Snail1 was detected by immunohistochemistry in 32 normal, 36 low-grade squamous intraepithelial neoplasia (LSIL), 54 high-grade squamous intraepithelial neoplasia (HSIL) and 320 cervical squamous cell carcinoma (CSCC) samples. The correlation between the expression of Twist1, Snail1 and squamous cell carcinoma antigen (SCCA) in CSCC tissues and clinical pathology results was evaluated. A transwell migration and invasion assay was used to explore the roles of Twist1 and Snail1 in the invasion of cancer cells. Lymph node metastasis and lymphovascular space invasion (LVSI) rates for the following groups were analysed: SCCA(+) group, Twist1(+) group, Snail1(+) group, Twist1(+)Snail1(+)group, Twist1(+)SCCA(+)group, Snail1(+)SCCA(+)group and Twist1(+)Snail1(+)SCCA(+) group. RESULTS: The expression of Twist1 and Snail1 was significantly upregulated in HSIL and CSCC (p < 0.05). Twist1 and Snail1 expression levels were associated with LVSI, lymph node metastasis and histological grade (p < 0.05) but not with age or FIGO stage (p > 0.05). The expression of SCCA was associated with LVSI, lymph node metastasis, FIGO stage and histological grade (p < 0.05) but not with age (p > 0.05). Twist1 was an independent factor contributing to the invasion ability of cervical cancer cells. In addition, the positive rate of lymph node metastasis and LVSI was higher in the Twist1(+)Snail1(+)SCCA(+) group than in the SCCA(+) group, Twist1(+) group and Snail1(+) group, respectively (p < 0.05). CONCLUSION: Combined detection of Twist1 and Snail1 in SCCA-positive biopsy specimens may be a potential method for evaluating the invasion and metastasis of CSCC prior to surgery.


Asunto(s)
Carcinoma de Células Escamosas/patología , Proteínas Nucleares/metabolismo , Factores de Transcripción de la Familia Snail/metabolismo , Proteína 1 Relacionada con Twist/metabolismo , Neoplasias del Cuello Uterino/patología , Adulto , Anciano , Antígenos de Neoplasias/metabolismo , Biomarcadores de Tumor/metabolismo , Biopsia , Carcinoma de Células Escamosas/metabolismo , Femenino , Humanos , Inmunohistoquímica , Ganglios Linfáticos/patología , Metástasis Linfática/patología , Persona de Mediana Edad , Proteínas Nucleares/genética , Cuidados Preoperatorios , Pronóstico , Serpinas/metabolismo , Factores de Transcripción de la Familia Snail/genética , Lesiones Intraepiteliales Escamosas de Cuello Uterino/patología , Proteína 1 Relacionada con Twist/genética , Neoplasias del Cuello Uterino/metabolismo
14.
Inorg Chem ; 56(14): 8341-8347, 2017 Jul 17.
Artículo en Inglés | MEDLINE | ID: mdl-28650625

RESUMEN

A CuI-loaded and n-pentadecyl-attached imidazolium salt decorated UiO-67-type metal-organic framework (CuI@UiO-67-IM, 2) based on a new premodified ligand L (n-pentadecyl-attached imidazolium (IM) decorated dicarboxylic acid) and ZrCl4 is reported. Compound 2 can be a bifunctional composite heterogeneous phase-transfer catalyst to promote the azide-alkyne cycloaddition (H2O, air, 80 °C) from corresponding halogenated compounds and sodium azide as a sequential one-pot procedure with high yields and excellent regioselectivity.

15.
Acta Biochim Biophys Sin (Shanghai) ; 49(6): 550-559, 2017 Jun 01.
Artículo en Inglés | MEDLINE | ID: mdl-28402481

RESUMEN

In the present study, we identified 50 peptides that are classified into 21 peptide families with antioxidant and/or antimicrobial activity from Amolops daiyunensis, Pelophylax hubeiensis, Hylarana maosuoensis and Nanorana pleskei, which belong to four different genera in the Ranidae and Dicroglossidae families. These four frog species were found for the first time to express antioxidant peptides (AOPs) and antimicrobial peptides (AMPs). These peptides include seven newly discovered families daiyunin-1, daiyunin-2, daiyunin-3, maosonensis-1MS1, pleskein-1, pleskein-2, and pleskein-3. Antioxidant and antimicrobial activity assays showed that some of these peptides have good biological activities. For example, at a concentration of 50 µM, nigroain-B-MS1, and nigroain-C-MS1 both exhibited relatively strong 2,2-diphenyl-1-picrylhydrazyl (DPPH) and 2,2'-azinobis-(3-ethylbenzothiazoline-6-sulfonicacid) (ABTS) free radical scavenging ability, with eradication rates of 99.7% and 68.3% (nigroain-B-MS1), and 99.8% and 58.3% (nigroain-C-MS1), respectively. These peptides are potential candidates for the development of novel antioxidant or AMP preparations.


Asunto(s)
Antiinfecciosos/aislamiento & purificación , Antioxidantes/aislamiento & purificación , Péptidos/aislamiento & purificación , Ranidae/metabolismo , Piel/metabolismo , Secuencia de Aminoácidos , Animales , Antiinfecciosos/farmacología , Antioxidantes/farmacología , Bacterias/efectos de los fármacos , Bacterias/crecimiento & desarrollo , Depuradores de Radicales Libres/aislamiento & purificación , Depuradores de Radicales Libres/farmacología , Hongos/efectos de los fármacos , Hongos/crecimiento & desarrollo , Hemólisis/efectos de los fármacos , Humanos , Pruebas de Sensibilidad Microbiana , Oxidación-Reducción/efectos de los fármacos , Péptidos/genética , Péptidos/farmacología , Ranidae/clasificación , Homología de Secuencia de Aminoácido
16.
J Hepatol ; 60(3): 523-9, 2014 Mar.
Artículo en Inglés | MEDLINE | ID: mdl-24269471

RESUMEN

BACKGROUND & AIMS: Despite appropriate immunoprophylaxis, HBV vertical transmission (VT) occurs in 5-10% of infants born to HBs-antigen (HBsAg)+ mothers. We investigated whether amniocentesis increases the risk of transmission. METHODS: We performed a case-control study on infants who were born to HBsAg+ mothers without antiviral exposure and completed appropriate immunization. Infants born to mothers with amniocentesis were compared to those without amniocentesis to assess VT rates, which were defined by the percentage of infants with HBsAg positivity when they were 7-12 months old. RESULTS: Of the 642 consecutive infants enrolled, 63 infants with amniocentesis were compared with 198 matched infants selected from the remaining 579 infants without amniocentesis. There was a higher VT rate in infants with amniocentesis than in those without amniocentesis (6.35% vs. 2.53%; p=0.226). Maternal HBV DNA levels before amniocentesis were further stratified to <500 copies/ml, 500-6.99 log10 copies/ml, and ⩾ 7 log10 copies/ml for subset analyses. There were no significant differences in the VT rates between the amniocentesis group and the control group if the maternal HBV DNA levels were <6.99 log10 copies/ml. However, a significantly higher VT rate was observed in the amniocentesis group vs. the control group if the maternal HBV DNA levels were ⩾ 7 log10 copies/ml (50% vs. 4.5%, respectively, p=0.006). According to baseline value risk analyses, performing amniocentesis on highly viremic mothers was a risk factor for HBV transmission (OR=21.3, 95% CI: 2.960-153.775). CONCLUSIONS: Amniocentesis performed on HBsAg+ mothers with HBV DNA ⩾ 7 log10 copies/ml significantly increased the frequency of VT. HBsAg+ women who plan to have amniocentesis should be evaluated for the risk of VT and stratified according to their HBV DNA levels. Further prospective studies are warranted to verify our findings.


Asunto(s)
Amniocentesis/efectos adversos , Antígenos de Superficie de la Hepatitis B/análisis , Hepatitis B/transmisión , Transmisión Vertical de Enfermedad Infecciosa , Adolescente , Adulto , Estudios de Casos y Controles , ADN Viral/análisis , Femenino , Hepatitis B/etiología , Humanos , Embarazo , Riesgo
17.
Zoolog Sci ; 31(7): 438-44, 2014 Jul.
Artículo en Inglés | MEDLINE | ID: mdl-25001915

RESUMEN

Twenty-two novel cDNAs encoding 22 peptide precursors for 19 mature peptides including antimicrobial peptides (AMPs) were identified from East Asian frog species Babina daunchina, Babina adenopleura, and Rana omeimontis skin-derived cDNA libraries. Two atypical members of the brevinin-1 family AMPs, named brevinin-1AN1 (FLTGVLKLASKIPSVLCAVLKTC) and brevinin-1DN1(FLKGVINLASKIPSMLCAVLKTC), were purified from the skin secretions of B. adenopleura and B. daunchina, respectively. A member of the ranatuerin-2 family AMP named ranatuerin-2DN1 (GLFDSITQGLKDTAVKLLDKIKCKLSACPPA) was also purified from the skin secretion of B. daunchina. One AMP named japonicin-2OM1 (FIVPSIFLLKKAFCIALKKNC) was purified from the skin secretion of R. omeimontis. The antimicrobial tests showed that brevinin-1DN1, brevinin-1DN2, brevinin-1AN1, and japonicin-2OM1 possess higher antimicrobial activity against Gram-positive bacteria than Gram-negative bacteria.


Asunto(s)
Péptidos Catiónicos Antimicrobianos/metabolismo , Ranidae/metabolismo , Piel/metabolismo , Secuencia de Aminoácidos , Animales , Péptidos Catiónicos Antimicrobianos/genética , Bacterias/efectos de los fármacos , Clonación Molecular , ADN Complementario/genética , ADN Complementario/metabolismo , Regulación de la Expresión Génica/fisiología , Datos de Secuencia Molecular , Ranidae/genética , Especificidad de la Especie
18.
Zoolog Sci ; 31(3): 143-51, 2014 Mar.
Artículo en Inglés | MEDLINE | ID: mdl-24601776

RESUMEN

Amphibian skin secretions contain abundant bioactive peptides that are valuable natural resources for human beings. However, many amphibians are disappearing from the world, making relevant scientific studies even more important. In this study, 24 cDNA sequences encoding antimicrobial peptide (AMP) precursors were initially cloned by screening a cDNA library derived from the skin of the Sichuan torrent frog, Amolops mantzorum. Eighteen mature AMPs belonging to 11 different families were deduced from these cDNA clones. Biological function was confirmed in each family of these AMPs. Some of them were purified from the skin secretions, and their molecular structures were determined by Edman degradation. Liquid chromatography in conjunction with tandem mass spectrometry (LC-MS/MS)-based peptidomics was used to further confirm the actual presence and characteristics of mature AMPs in the skin secretions of A. mantzorum. Incomplete tryptic digestion and gas-phase fractionation (GPF) analysis were used to increase the peptidome coverage and reproducibility of peptide ion selection.


Asunto(s)
Péptidos Catiónicos Antimicrobianos/química , Péptidos Catiónicos Antimicrobianos/metabolismo , Ranidae/fisiología , Piel/metabolismo , Secuencia de Aminoácidos , Animales , Péptidos Catiónicos Antimicrobianos/farmacología , Cromatografía Liquida , Clonación Molecular , ADN Complementario , Eritrocitos/efectos de los fármacos , Eritrocitos/ultraestructura , Escherichia coli/efectos de los fármacos , Regulación de la Expresión Génica/fisiología , Humanos , Espectrometría de Masas en Tándem
19.
JAMA Netw Open ; 7(7): e2420717, 2024 Jul 01.
Artículo en Inglés | MEDLINE | ID: mdl-38980674

RESUMEN

Importance: Air pollution is associated with structural brain changes, disruption of neurogenesis, and neurodevelopmental disorders. The association between prenatal exposure to ambient air pollution and risk of cerebral palsy (CP), which is the most common motor disability in childhood, has not been thoroughly investigated. Objective: To evaluate the associations between prenatal residential exposure to ambient air pollution and risk of CP among children born at term gestation in a population cohort in Ontario, Canada. Design, Setting, and Participants: Population-based cohort study in Ontario, Canada using linked, province-wide health administrative databases. Participants were singleton full term births (≥37 gestational weeks) born in Ontario hospitals between April 1, 2002, and March 31, 2017. Data were analyzed from January to December 2022. Exposures: Weekly average concentrations of ambient fine particulate matter with a diameter 2.5 µm (PM2.5) or smaller, nitrogen dioxide (NO2), and ozone (O3) during pregnancy assigned by maternal residence reported at delivery from satellite-based estimates and ground-level monitoring data. Main outcome and measures: CP cases were ascertained by a single inpatient hospitalization diagnosis or at least 2 outpatient diagnoses for children from birth to age 18 years. Results: The present study included 1 587 935 mother-child pairs who reached term gestation, among whom 3170 (0.2%) children were diagnosed with CP. The study population had a mean (SD) maternal age of 30.1 (5.6) years and 811 745 infants (51.1%) were male. A per IQR increase (2.7 µg/m3) in prenatal ambient PM2.5 concentration was associated with a cumulative hazard ratio (CHR) of 1.12 (95% CI, 1.03-1.21) for CP. The CHR in male infants (1.14; 95% CI, 1.02-1.26) was higher compared with the CHR in female infants (1.08; 95% CI, 0.96-1.22). No specific window of susceptibility was found for prenatal PM2.5 exposure and CP in the study population. No associations or windows of susceptibility were found for prenatal NO2 or O3 exposure and CP risk. Conclusions and relevance: In this large cohort study of singleton full term births in Canada, prenatal ambient PM2.5 exposure was associated with an increased risk of CP in offspring. Further studies are needed to explore this association and its potential biological pathways, which could advance the identification of environmental risk factors of CP in early life.


Asunto(s)
Contaminación del Aire , Parálisis Cerebral , Material Particulado , Efectos Tardíos de la Exposición Prenatal , Humanos , Embarazo , Femenino , Parálisis Cerebral/epidemiología , Parálisis Cerebral/etiología , Efectos Tardíos de la Exposición Prenatal/epidemiología , Contaminación del Aire/efectos adversos , Contaminación del Aire/análisis , Contaminación del Aire/estadística & datos numéricos , Masculino , Ontario/epidemiología , Adulto , Material Particulado/efectos adversos , Material Particulado/análisis , Lactante , Preescolar , Recién Nacido , Niño , Exposición Materna/efectos adversos , Exposición Materna/estadística & datos numéricos , Estudios de Cohortes , Contaminantes Atmosféricos/efectos adversos , Contaminantes Atmosféricos/análisis , Adolescente , Dióxido de Nitrógeno/efectos adversos , Dióxido de Nitrógeno/análisis
20.
Medicine (Baltimore) ; 103(31): e39143, 2024 Aug 02.
Artículo en Inglés | MEDLINE | ID: mdl-39093809

RESUMEN

RATIONALE: Single coronary artery (SCA) is a rare coronary artery malformation. SCA combined with atherosclerotic plaques can cause severe and widespread myocardial ischemia and infarction, leading to hemodynamic instability and even sudden death. PATIENT CONCERNS: A 48-year-old Chinese man was admitted for treatment of persistent chest tightness and panic for 5 hours. The patient was a lorry driver with high work intensity and mental stress, with body mass index of 33.78, history of smoking and alcohol consumption, but no history of hypertension and diabetes. DIAGNOSES: Admission examination showed Troponin was 183.083 µg/L and CK-MB value was >300 µg/L. The patient was diagnosed with a congenital single right coronary artery (RCA) with acute myocardial infarction (AMI) by coronary angiography (CAG). Due to atherosclerotic plaques rupture, a complete occlusion of the proximal RCA with thrombolysis in myocardial infarction grade 0 of distal blood flow were found. INTERVENTIONS AND OUTCOMES: The patient was treated with thrombus aspiration and thrombolytic therapy by percutaneous coronary intervention under the support of intra-aortic balloon pump. Postoperative the chest tightness and panic were relieved, and CAG revealed that the proximal thrombus of the RCA was reduced, and distal blood flow was restored to thrombolysis in myocardial infarction grade 3. After 2 weeks of intensive antithrombotic and lipid-regulating drug therapy, the patient was successfully discharged. Follow-up for 6 months, the patient was able to live and work normally without experiencing chest tightness and chest pain. Computed tomography angiography (CTA) confirmed a congenital single RCA with patent lumen and no severe stenosis. LESSONS: The congenital single RCA is very rare, and it is fatal in conjunction with acute coronary syndrome. Early detection and appropriate treatment is critical for AMI patient with single RCA. CAG is the gold standard for diagnosis of single RCA, and CTA is a necessary to describe the anatomical course of abnormal coronary arteries.


Asunto(s)
Anomalías de los Vasos Coronarios , Infarto del Miocardio , Intervención Coronaria Percutánea , Humanos , Masculino , Persona de Mediana Edad , Anomalías de los Vasos Coronarios/cirugía , Anomalías de los Vasos Coronarios/diagnóstico , Anomalías de los Vasos Coronarios/complicaciones , Anomalías de los Vasos Coronarios/terapia , Infarto del Miocardio/terapia , Intervención Coronaria Percutánea/métodos , Angiografía Coronaria
SELECCIÓN DE REFERENCIAS
Detalles de la búsqueda