RESUMEN
OBJECTIVE: The study's objective was to summarize the psychometric evaluation of self-report symptom instruments used in children with cancer younger than 8 years of age. METHODS: We conducted electronic searches of Ovid Medline, EMBASE, PsycInfo, Science Citation, Social Science Citation (Web of Science), and CINAHL. We included studies of children with cancer in which their self-report symptoms had been quantified and in which results were described for those younger than 8 years of age. The search was restricted to publications in English. Two reviewers screened studies and abstracted all data in duplicate. Descriptive analysis of reliability and validity was performed. RESULTS: Thirteen studies were included. Only one study recruited children <8 years alone. Most studies described reliability and validity in a wider age range cohort in which most children were older than 8 years of age. Of the eight studies that evaluated reliability within the younger age group, six raised concerns about poor internal consistency with Cronbach's alpha <0.7 in at least one dimension. Concerns about test re-test reliability and inter-rater reliability were also observed. None of the studies evaluated validity. CONCLUSIONS: We failed to demonstrate that currently available instruments to measure self-report symptoms are reliable or valid specifically for children with cancer younger than 8 years of age. Development of psychometrically robust instruments for younger children should be a priority.
Asunto(s)
Neoplasias/diagnóstico , Psicometría/métodos , Niño , Preescolar , Femenino , Humanos , Masculino , Reproducibilidad de los Resultados , AutoinformeRESUMEN
PURPOSE: Symptom burden in children with cancer who are less than 8 years old is not well understood. Our research focuses on identifying how to structure a self-report instrument for younger children. Our aim was to describe how children with cancer, aged 4-7 years, express their symptoms through drawings. METHODS: Children were asked to make drawings of a day when they were "feeling bad or not good". Content of 18 children's drawings was analyzed. RESULTS: Four themes were established: physical symptoms, emotions, location and miscellaneous. Most of the drawings illustrated specific symptoms important to this age group, while also facilitating our understanding of how children with cancer view their symptoms. CONCLUSION: Having children draw pictures may help initiate communication regarding how they feel, and develop rapport between the interviewer and children.
Asunto(s)
Arte , Comunicación , Neoplasias/complicaciones , Neoplasias/psicología , Evaluación de Síntomas , Factores de Edad , Niño , Preescolar , Emociones , Femenino , Humanos , MasculinoRESUMEN
Isothermal titration calorimetry, ITC, has been used to determine the thermodynamics (DeltaG, DeltaH, and -TDeltaS) for binding netropsin to a number of DNA constructs. The DNA constructs included: six different 20-22mer hairpin forming sequences and an 8-mer DNA forming a duplex dimer. All DNA constructs had a single -AT-rich netropsin binding with one of the following sequences, (A(2)T(2))(2), (ATAT)(2), or (AAAA/TTTT). Binding energetics are less dependent on site sequence than on changes in the neighboring single stranded DNA (hairpin loop size and tail length). All of the 1:1 complexes exhibit an enthalpy change that is dependent on the fractional saturation of the binding site. Later binding ligands interact with a significantly more favorable enthalpy change (partial differential DeltaH(1-2) from 2 to 6 kcal/mol) and a significantly less favorable entropy change (partial differential (-TDeltaS(1-2))) from -4 to -9 kcal/mol). The ITC data could only be fit within expected experimental error by use of a thermodynamic model that includes two independent binding processes with a combined stoichiometry of 1 mol of ligand per 1 mol of oligonucleotide. Based on the biophysical evidence reported here, including theoretical calculations for the energetics of "trapping" or structuring of a single water molecule and molecular docking computations, it is proposed that there are two modes by which flexible ligands can bind in the minor groove of duplex DNA. The higher affinity binding mode is for netropsin to lay along the floor of the minor groove in a bent conformation and exclude all water from the groove. The slightly weaker binding mode is for the netropsin molecule to have a slightly more linear conformation and for the required curvature to be the result of a water molecule that bridges between the floor of the minor groove and two of the amidino nitrogens located at one end of the bound netropsin molecule.
Asunto(s)
ADN/química , Netropsina/química , Conformación de Ácido Nucleico , Termodinámica , Secuencia de Bases , Calorimetría , Ligandos , Oligonucleótidos/química , Conformación ProteicaRESUMEN
A novel protein with factor Xa-like activity was isolated from Lonomia obliqua caterpillar spicules by gel filtration chromatography and reversed-phase high-performance liquid chromatography. The protein had a mass of 20745.7 Da, as determined by mass spectrometry, and contained four Cys residues. Enzymatic hydrolysis followed by de novo sequencing by tandem mass spectrometry was used to determine the primary structure of the protein and the cysteine residues linked by disulfide bridges. The positions of 24 sequenced tryptic peptides, including the N-terminal, were deduced by comparison with a homologous protein from the superfamily Bombycoidea. Approximately 90% of the primary structure of the active protein was determined.
Asunto(s)
Factor Xa/aislamiento & purificación , Factor Xa/metabolismo , Lepidópteros/química , Lepidópteros/crecimiento & desarrollo , Alquilación , Secuencia de Aminoácidos , Animales , Cromatografía Líquida de Alta Presión , Disulfuros/análisis , Disulfuros/química , Factor Xa/química , Espectrometría de Masas , Datos de Secuencia MolecularRESUMEN
A new Phospholipase A(2) (PLA(2)) from Micrurus dumerilii carinicauda venom was isolated and its primary structure determined. This new PLA(2) showed a low enzymatic activity when compared with other PLA(2)s and it is moderately basic with an isoelectric point of 8.0. Its amino acid sequence showed the presence of 120 amino acid residues and its sequence was: NLIQFLNMIQCTTPGREPLVAFANYGCYCGRGGSGTPVDELDRCCQVHDNCYDTAKKVFGCSPYFTMYSYDCSEGKLTCKDNNTKCKAAVCNCDRTAALCFAKAPYNDKNYKIDLTKRCQ. The structural model of MIDCA1, when compared with other strong neurotoxic PLA(2)s, such as Naja naja, showed significant differences in the beta-wing and neurotoxic sites, despite the high level of amino acid sequence similarity. These observations indicate a dissociation between the biological and catalytic activity of this new PLA(2), supporting the view that other regions of the protein are involved in the biological effects.
Asunto(s)
Secuencia de Aminoácidos , Venenos Elapídicos/enzimología , Fosfolipasas A/genética , Animales , Elapidae , Modelos Moleculares , Datos de Secuencia Molecular , Fosfolipasas A/química , Fosfolipasas A/aislamiento & purificación , Estructura Terciaria de Proteína , Alineación de SecuenciaRESUMEN
We evaluated 197 patients with predominantly late-onset Alzheimer's disease (AD) who belonged to several ethnic groups and analyzed the relationship of age of onset of AD to the presence or absence of several risk factors in this entire group of patients. The apolipoprotein E (apoE) epsilon 4 allele frequency, which was 29% in all patients (compared with the reported population mean of 13.7%, p < 0.001, did not vary significantly between ethnic groups but declined significantly with increasing age. The apoE epsilon 2 allele frequency was 3%, compared with the reported population mean of 7.4% (p = 0.001). The frequency of a positive family history of dementia in first-degree relatives (FH +) (overall 45%) did not vary significantly between ethnic groups. ApoE epsilon 4-positive (epsilon 4+) patients tended to have a higher FH + rate (58%) than apoE epsilon 4-negative (epsilon 4-) patients (40%) (p = 0.02). When the potential risk factors of gender, education, FH+ status, and epsilon 4+ status were examined together in a multiple linear-regression analysis, FH+ and epsilon 4+ status (but not gender or education) were significant (they were both associated with an earlier age of onset of AD). In a post-hoc analysis, we found a reduced age of onset in women, but not men, who were both FH + and epsilon 4+. Additionally, those probands who were epsilon 4+ were more likely to inherit the disease from their mothers than their fathers. The mechanism by which epsilon 4+ and FH+ status operate as risk factors may be by their effect on the age of onset of AD.
Asunto(s)
Enfermedad de Alzheimer/epidemiología , Negro o Afroamericano , Edad de Inicio , Anciano , Alelos , Enfermedad de Alzheimer/etnología , Enfermedad de Alzheimer/genética , Apolipoproteína E4 , Apolipoproteínas E/genética , Demencia/genética , Escolaridad , Femenino , Florida/epidemiología , Frecuencia de los Genes , Hispánicos o Latinos , Humanos , Judíos , Masculino , Persona de Mediana Edad , Factores de Riesgo , Población BlancaRESUMEN
Whether all etiologic forms of Alzheimer's disease (AD) share a final common pathway is a major issue. We determined the severity and regional distribution of neuronal loss, amyloid plaques, neuritic plaques (NPs), and neurofibrillary tangles (NFTs), and calculated the ratio of neuronal loss to NPs and NFTs in brains of 19 familial AD (FAD) patients with linkage to chromosome 14, six AD patients with mutations of chromosome 21 (codon 717 of the beta-amyloid percursor protein gene), and 11 sporadic AD (SAD) patients. There was no difference in the pattern of distribution of the various pathologic features or in the ratio of neuronal loss to NPs or NFTs in any AD group. However, FAD groups could be distinguished from SAD by the greater severity and the lack of influence of apolipoprotein E genotype on pathology. These differences may reflect differences in age at onset rather than different etiopathologic mechanisms. The similarity of pathologic findings in the different AD groups provides evidence for a final common pathophysiologic pathway in AD.
Asunto(s)
Enfermedad de Alzheimer/genética , Enfermedad de Alzheimer/patología , Encéfalo/patología , Neuronas/patología , Edad de Inicio , Anciano , Alelos , Enfermedad de Alzheimer/etiología , Amiloide/análisis , Precursor de Proteína beta-Amiloide/genética , Análisis de Varianza , Apolipoproteínas E/genética , Cerebelo/patología , Cromosomas Humanos Par 14 , Cromosomas Humanos Par 21 , Frecuencia de los Genes , Ligamiento Genético , Humanos , Persona de Mediana Edad , Mutación , Neuritas/patología , Ovillos Neurofibrilares/patología , Especificidad de ÓrganosRESUMEN
In southern Brazil, envenomation by larvae of the moth Lonomia obliqua (Walker) may result in blood clotting factor depletion, leading to disseminated intravascular coagulation with subsequent haemorrhage and acute renal failure which may prove fatal. We have examined the effect of a crude extract of spicules from these caterpillars on in vitro hemostasis. The extract alone did not aggregate platelets and had no detectable effect on purified fibrinogen, suggesting that extract induces clot formation by triggering activation of the clotting cascade. In agreement with the presence of thrombin-mediated activity, hirudin prevented clot formation. The extract was found to activate both prothrombin and factor X, suggesting that the depletion of blood clotting factors results from the steady activation of factor X and prothrombin. Heating and diisopropylfluorophosphate abolished the procoagulant activity of the extract, indicating that the active component involved is a protein that may belong to the serine protease family of enzymes. The ability of hirudin to inhibit this coagulant activity suggests that this inhibitor could be beneficial in the treatment of patients envenomed by L. obliqua caterpillars.
Asunto(s)
Venenos de Artrópodos , Coagulación Sanguínea , Factor X/metabolismo , Mariposas Nocturnas , Protrombina/metabolismo , Animales , HumanosRESUMEN
1. The effect of purified crotapotin, a non-toxic non-enzymatic chaperon protein normally complexed to a phospholipase A2 (PLA2) in South America rattlesnake venom, was studied in the acute inflammatory response induced by carrageenin (1 mg/paw), compound 48/80 (3 micrograms/paw) and 5-hydroxytryptamine (5-HT) (3 micrograms/paw) in the rat hind-paw. The effects of crotapotin on platelet aggregation, mast cell degranulation and eicosanoid release from guinea-pig isolated lung were also investigated. 2. Subplantar co-injection of crotapotin (1 and 10 micrograms/paw) with carrageenin or injection of crotapotin (10 micrograms/paw) into the contralateral paw significantly inhibited the carrageenin-induced oedema. This inhibition was also observed when crotapotin (10-30 micrograms/paw) was administered either intraperitoneally or orally. Subplantar injection of heated crotapotin (15 min at 60 degrees C) failed to inhibit carrageenin-induced oedema. Subplantar injection of crotapotin (10 micrograms/paw) also significantly inhibited the rat paw oedema induced by compound 48/80, but it did not affect 5-HT-induced oedema. 3. In adrenalectomized animals, subplantar injection of crotapotin markedly inhibited the oedema induced by carrageenin. The inhibitory effect of crotapotin was also observed in rats depleted of histamine and 5-HT stores. 4. Crotapotin (30 micrograms/paw) had no effect on either the histamine release induced by compound 48/80 in vitro or on the platelet aggregation induced by both arachidonic acid (1 nM) and platelet activating factor (1 microM) in human platelet-rich plasma. The platelet aggregation and thromboxane B2 (TXB2) release induced by thrombin (100 mu ml-1) in washed human platelets were also not affected by crotapotin. In addition, crotapotin (10 microg/paw) did not affect the release of 6-oxo-prostaglandin Fla, and TXB2 induced by ovalbumin in sensitized guinea-pig isolated lungs.5. Our results indicate that the anti-inflammatory activity of crotapotin is not due to endogenous corticosteroid release or inhibition of cyclo-oxygenase activity. It is possible that crotapotin may interact with extracellular PLA2 generated during the inflammatory process thereby reducing its hydrolytic activity.
Asunto(s)
Crotoxina/uso terapéutico , Edema/tratamiento farmacológico , Fosfolipasas A/metabolismo , 6-Cetoprostaglandina F1 alfa/metabolismo , Administración Oral , Animales , Ácido Araquidónico/farmacología , Carragenina/administración & dosificación , Carragenina/toxicidad , Degranulación de la Célula/efectos de los fármacos , Crotoxina/administración & dosificación , Crotoxina/farmacología , Modelos Animales de Enfermedad , Edema/inducido químicamente , Cobayas , Liberación de Histamina/efectos de los fármacos , Humanos , Inyecciones Intraperitoneales , Masculino , Mastocitos/efectos de los fármacos , Mastocitos/fisiología , Fosfolipasas A2 , Factor de Activación Plaquetaria/farmacología , Agregación Plaquetaria/efectos de los fármacos , Ratas , Ratas Wistar , Serotonina/administración & dosificación , Serotonina/toxicidad , Tromboxano B2/metabolismo , p-Metoxi-N-metilfenetilamina/administración & dosificación , p-Metoxi-N-metilfenetilamina/toxicidadRESUMEN
The increased endothelin-1 levels observed after smoking may result from nicotine-stimulated endothelin-1 production by endothelial cells. In this study, we investigated the effects of selective endothelin ET(A) receptors antagonist Cycle D-a-aspartyl-L-prolyl-D-isoleucyl-D-tryptophyl (JKC 301) and of endothelin ET(B) receptors antagonist N-cis-2, 6-dimethylpiperidino-carbonyl-L-gamma-methyl-leucyl-D-L-m ethoxycarbonyl-tryptophanyl-norleucine (BQ 788) on the changes in mean arterial pressure, heart rate, and plasma thromboxane B(2) (the stable product of thromboxane A(2)) levels caused by increasing doses of nicotine (0.6, 2, 6, and 20 micromol/kg) in anesthetised rats. Nicotine (0.6, 2, and 6 micromol/kg) significantly increased the mean arterial pressure in control and BQ 788-pretreated rats, while only a nicotine dose of 2 micromol/kg) increased the mean arterial pressure in JKC 301-pretreated animals. There were no differences in the nicotine-induced changes in heart rate or in the increases in thromboxane B(2) levels among the groups treated with saline, JKC 301 and BQ 788. These results demonstrate that whereas the antagonism of endothelin ET(A) receptors attenuated the increase in blood pressure after nicotine injections, endothelin ET(B) receptor antagonism had no such effect. In addition, the antagonism of endothelin ET(A) or ET(B) receptors did not affect thromboxane A(2) production after nicotine administration. These findings suggest that endothelin-1 may have a role in the acute effects of nicotine.
Asunto(s)
Presión Sanguínea/efectos de los fármacos , Antagonistas de los Receptores de Endotelina , Nicotina/antagonistas & inhibidores , Agonistas Nicotínicos/farmacología , Animales , Frecuencia Cardíaca/efectos de los fármacos , Masculino , Nicotina/farmacología , Ratas , Ratas Wistar , Receptor de Endotelina A , Receptor de Endotelina B , Tromboxano B2/sangreRESUMEN
The anti-inflammatory effects of Ph CL28A, a potentiator of prostacyclin output and inhibitor of leukotriene (LT) synthesis, were assessed in two models of acute inflammation. In paw oedema induced by carrageenan in rats, Ph CL28A (10-100 mg/kg), given i.p. at the same time as the carrageenan, inhibited oedema for up to 4 h. When indomethacin or Ph CL28A was given locally into the paw with carrageenan, indomethacin inhibited oedema formation but Ph CL28A potentiated the oedema for up to 4 h. As Ph CL28A does not inhibit cyclo-oxygenase, its anti-inflammatory effects in this model may reflect its ability to increase prostacyclin output. In pleurisy induced by carrageenan in rats, there were increases in leukocytes, LTB4, thromboxane B2 (TxB2) and 6-oxo-prostaglandin F1 alpha (6-oxo-PGF1 alpha) in the pleural fluid over 3 h. In this model, Ph CL28A (30 mg/kg) given i.p. decreased leukocyte numbers and LTB4 but did not affect TxB2 or 6-oxo-PGF1 alpha. Indomethacin decreased both prostanoids but did not affect leukocyte accumulation. The beneficial effects of Ph CL28A in two different models of acute inflammation suggests that it may have potential as an anti-inflammatory agent.
Asunto(s)
Antiinflamatorios no Esteroideos/farmacología , Compuestos Azo/farmacología , Hidroxiprostaglandina Deshidrogenasas/antagonistas & inhibidores , 6-Cetoprostaglandina F1 alfa/biosíntesis , Animales , Presión Sanguínea/efectos de los fármacos , Carragenina , Edema/inducido químicamente , Edema/prevención & control , Epoprostenol/biosíntesis , Indometacina/farmacología , Leucotrieno B4/biosíntesis , Masculino , Pleuresia/inducido químicamente , Pleuresia/prevención & control , Radioinmunoensayo , Ratas , Ratas Wistar , Tromboxano B2/biosíntesisRESUMEN
Nitro-L-arginine methyl ester (0.15 mumol/paw) significantly reduced both bradykinin- and 5-hydroxytryptamine-induced rat paw oedema. At this dose, L-arginine (L-Arg), D-Arg and nitro-D-arginine methyl ester had no effect on the oedematogenic responses induced by these agents. Nitro-L-arginine methyl ester, nitro-D-arginine methyl ester, L-Arg, D-Arg, L-arginine methyl ester and L-arginine ethyl ester, at the dose of 15 mumol/paw, significantly potentiated both bradykinin- and 5-hydroxytryptamine-induced oedema. This potentiation was not observed in animals treated with both mepyramine and methysergide or in animals chronically treated with compound 48/80. Nitro-L-arginine methyl ester (0.3-3 mM) and L-Arg (0.3-3 mM) released small amounts (< 10%) of histamine from rat peritoneal mast cells when compared to compound 48/80-induced degranulation (> 40%). Histamine release was quantified by radioimmunoassay since nitro-L-arginine methyl ester and L-Arg interfere with the fluorometric assay. The potentiation of paw oedema observed with higher doses of all arginine analogues is caused by in vivo mast cell degranulation and is probably due to the cationic charge of these substances.
Asunto(s)
Arginina/análogos & derivados , Inflamación/inmunología , Mastocitos/efectos de los fármacos , Óxido Nítrico/antagonistas & inhibidores , Animales , Arginina/farmacología , Bradiquinina/farmacología , Edema/inducido químicamente , Edema/inmunología , Miembro Posterior , Liberación de Histamina/efectos de los fármacos , Masculino , Mastocitos/metabolismo , Metisergida/farmacología , NG-Nitroarginina Metil Éster , Pirilamina/farmacología , Radioinmunoensayo , Ratas , Ratas Wistar , Serotonina/metabolismo , Serotonina/farmacologíaRESUMEN
The effect of neonatal capsaicin (8 methyl-N-vanillyl-6-nonenamide) treatment on the leucocyte infiltration into the airways and pleural cavity was investigated in rats actively sensitized with ovalbumin. The animals were neonatally injected with either capsaicin (50 mg/kg, s.c., 2nd day of life) or vehicle (10% ethanol and 10% Tween 80). At adult ages, the animals were actively sensitized with ovalbumin (200 microg, s.c.) and 14 days later they were intratracheally (or intrapleurally) challenged with ovalbumin. The substance P level in bronchoalveolar lavage fluid of the capsaicin group was reduced by >90% compared to control group (vehicle), confirming the efficacy of capsaicin treatment. In the capsaicin group, the number of neutrophils (but not of eosinophils and mononuclear cells) in bronchoalveolar lavage fluid of sensitized animals was significantly higher than the control group. Intrapleural injection of ovalbumin in sensitized rats caused a significant neutrophil influx at 6 h that was markedly increased in the capsaicin-pretreated animals compared to control group. The counts of eosinophils and mononuclear cells in the pleural exudates did not differ significantly between capsaicin and control groups. The increased levels of immunoglobulin (Ig)E, IgG1 and IgG2a anti-ovalbumin antibodies in serum of sensitized rats did not differ between capsaicin and control groups. In conclusion, the exacerbated pulmonary neutrophil recruitment caused by the capsaicin neonatal treatment is unrelated to increase in serum immunoglobulin antibodies, and suggests a protective role for C-fibers in attenuating the allergic neutrophil infiltration.
Asunto(s)
Líquido del Lavado Bronquioalveolar/citología , Capsaicina/farmacología , Leucocitos/efectos de los fármacos , Fibras Nerviosas/fisiología , Pleura/efectos de los fármacos , Animales , Animales Recién Nacidos , Anticuerpos/sangre , Anticuerpos/efectos de los fármacos , Líquido del Lavado Bronquioalveolar/química , Recuento de Células , Femenino , Inmunoglobulina E/sangre , Inmunoglobulina E/efectos de los fármacos , Inmunoglobulina G/sangre , Inmunoglobulina G/efectos de los fármacos , Leucocitos/citología , Masculino , Ovalbúmina/administración & dosificación , Ovalbúmina/inmunología , Pleura/citología , Pleuresia/inducido químicamente , Pleuresia/fisiopatología , Ratas , Ratas Wistar , Sustancia P/metabolismoRESUMEN
In the isolated rat heart, Phoneutria nigriventer spider venom (10-100 microg) produced a dose-dependent and reversible rise in left ventricular developed pressure. A low dose (10 microg) of venom induced a short-lasting, positive inotropic effect (P < 0.05) with no change in heart rate or coronary flow. At a dose of 50 microg, the venom caused significant positive inotropic and chronotropic responses associated with occasional ventricular arrhythmia, whereas coronary flow was not significantly affected within 10 min after venom administration. The highest dose of venom (100 microg) caused bradycardia, transient cardiac arrest, rhythm disturbances and an increase in end diastolic pressure followed by a reduction in coronary flow. Hearts treated with the non-selective beta-adrenoceptor antagonist propranolol (3 microM) and the selective beta1-adrenoceptor antagonist CGP-20712A (10 microM) were protected against all the cardiac actions of the venom. The selective beta2-adrenoceptor antagonist butoxamine (10 microM) slightly reduced the cardiac response to 50 microg, but not to 100 microg of venom. Butoxamine also prevented the reduction in coronary flow induced by 100 microg of venom. Hearts from reserpine-treated rats (5 mg kg(-1) day(-1), i.p., for 2 days) showed a marked decrease in all venom (< or = 100 microg)-induced cardiac responses. The muscarinic receptor antagonist atropine (1 microM) slightly potentiated the response to 50 microg of venom but had little or no effect on the responses to 100 microg of venom. The cardiac responses to venom (50-100 microg) were unaltered in hearts from rats treated with 8-methyl N-vanillyl-6-nonenamide (capsaicin; 50 mg/kg, s.c.). These findings indicate that P. nigriventer venom releases norepinephrine from cardiac sympathetic nerve endings and this may explain the observed increase in contractile force and heart rate.
Asunto(s)
Sistema Nervioso Autónomo/efectos de los fármacos , Corazón/efectos de los fármacos , Venenos de Araña/farmacología , Inhibidores de Captación Adrenérgica/farmacología , Antagonistas Adrenérgicos beta/farmacología , Animales , Antiarrítmicos/farmacología , Arácnidos/química , Atropina/farmacología , Sistema Nervioso Autónomo/fisiología , Butoxamina/farmacología , Capsaicina/farmacología , Gasto Cardíaco/efectos de los fármacos , Corazón/inervación , Hipertensión/inducido químicamente , Hipotensión/inducido químicamente , Imidazoles/farmacología , Técnicas In Vitro , Masculino , Propranolol/farmacología , Ratas , Ratas Wistar , Reserpina/farmacologíaRESUMEN
The cardiovascular, respiratory and metabolic effects of B. gabonica venoms obtained from specimens originating from Ghana, Togo, Nigeria, Uganda and Tanzania were examined in anaesthetized rabbits. Intravenous injection of all venoms (0.125-2.0 mg/kg) induced hypotension. Nigeria venom was the least potent in this respect. Following doses of all venoms there was a brief bradycardia and a transient increase in respiratory rate and depth. At high doses (greater than or equal to 1.0 mg/kg), all venoms induced severe ST depression and T wave inversion. In addition, Togo venom, and to a lesser extent Tanzania and Ghana venoms, were potent in inducing extrasystoles. None of the venoms produced any significant changes in haematocrit, plasma proteins or arterial blood gas and pH levels. All venoms increased blood glucose and lactate levels by 1.3-2.1 fold and 2.2-4.0 fold respectively while the respiratory quotient remained unchanged. Togo venom was significantly (P less than 0.05) more lethal than the other venoms. The pattern of haemorrhage observed at post-mortem was the same for all venoms with the heart, ureters, adrenals, kidneys, lungs, stomach and intestines being the most affected. When combined on a subspecies basis, the results suggest that there are no significant differences in the physiological effects of venoms representing B. g. rhinoceros (West African gaboon viper) and B. g. gabonica (East African gaboon viper).
Asunto(s)
Venenos de Víboras/toxicidad , África Oriental , África Occidental , Animales , Glucemia/metabolismo , Presión Sanguínea/efectos de los fármacos , Dióxido de Carbono/sangre , Electrocardiografía/efectos de los fármacos , Femenino , Frecuencia Cardíaca/efectos de los fármacos , Hematócrito , Hemodinámica/efectos de los fármacos , Hemorragia/inducido químicamente , Hemorragia/patología , Concentración de Iones de Hidrógeno , Lactatos/sangre , Masculino , Oxígeno/sangre , Conejos , Respiración/efectos de los fármacosRESUMEN
Crotalus durissus terrificus (South American rattlesnake) venom possesses myotoxic and neurotoxic activities, both of which are also expressed by crotoxin, the principal toxin of this venom. We have investigated the ability of commercial equine antivenom and antivenoms raised in rabbits against C. d. terrificus venom and crotoxin to neutralize the physiological and morphological changes induced by this venom and crotoxin in electrically-stimulated phrenic nerve-diaphragm (PND) and extensor digitorum longus (EDL) preparations of mice. The time required to produce 50% neuromuscular blockade in the PND and EDL preparations was, respectively, 103+/-9 and 59+/-6 min for C. d. terrificus venom (10 microg/ml) and 75+/-9 and 110+/-7 min for crotoxin (10 microg/ml). The antivenoms dose-dependently inhibited this neuromuscular activity of the venom and crotoxin. At a venom:antivenom ratio of 1:3, the rabbit antivenoms were as effective as the commercial equine antivenom. The creatine kinase (CK) concentrations in the organ bath containing EDL muscle were 290 and 1020 U/l following a 120 min exposure to C. d. terrificus venom and crotoxin, respectively. All of the antivenoms neutralized the release of CK by crotoxin, but were ineffective against C. d. terrificus venom. Histological analysis of the two preparations showed that rabbit anticrotoxin antivenom protected against the myotoxic action of C. d. terrificus venom and crotoxin better than the other antivenoms. We conclude that antisera raised in rabbits are better than equine antiserum in neutralizing the neurotoxic and myotoxic activities of C. d. terrificus venom and crotoxin.
Asunto(s)
Venenos de Crotálidos/inmunología , Crotoxina/inmunología , Sueros Inmunes/inmunología , Animales , Antivenenos/farmacología , Venenos de Crotálidos/toxicidad , Crotoxina/toxicidad , Caballos , Masculino , Ratones , Músculos/efectos de los fármacos , Bloqueo Neuromuscular , Pruebas de Neutralización , Nervio Frénico/efectos de los fármacos , ConejosRESUMEN
Bothropstoxin-I (BthTX-I), the principal myotoxin of Bothrops jararacussu venom, is devoid of phospholipase A(2) (PLA(2)) activity but capable of blocking neuromuscular transmission in mouse nerve-muscle preparations. In this study, the ability of crotoxin antiserum and heparin in preventing the neurotoxic and myotoxic effects of BthTX-I was investigated. Phrenic nerve-diaphragm preparations (PND) stimulated indirectly with supramaximal stimuli (0.2 ms, 0.1 Hz) were incubated with BthTX-I (20 microg/ml) alone or with BthTX-I preincubated with antiserum or heparin for 30 min at 37 degrees C prior to testing. Control preparations were incubated with Tyrode solution, antiserum or heparin alone. BthTX-I (20 microg/ml) produced 50% neuromuscular blockade in the PND preparations in 31+/-4min, with complete blockade occurring in 120 min. The antiserum and heparin significantly prevented the neuromuscular blockade caused by BthTX-I (84 +/- 4% and 100% protection, respectively). Light microscopy examination of the muscles at the end of the 120 min incubation showed that BthTX-I damaged 48 +/- 6% of the fibers. Preincubating the toxin with antivenom significantly reduced the extent of this damage (only 15 +/- 4% of fibers affected, corresponding to 69% protection, P<0.01) whereas heparin offered no protection (34 +/- 7% of fibers affected, not significantly different from that seen with toxin alone). These results show that the antivenom was more effective in neutralizing the myotoxic effects of BthTX-I than was heparin.
Asunto(s)
Antivenenos/farmacología , Venenos de Crotálidos/antagonistas & inhibidores , Crotoxina/antagonistas & inhibidores , Inmunoglobulina G/análisis , Músculo Esquelético/efectos de los fármacos , Nervio Frénico/efectos de los fármacos , Animales , Antivenenos/inmunología , Antivenenos/uso terapéutico , Bothrops , Venenos de Crotálidos/inmunología , Venenos de Crotálidos/toxicidad , Crotoxina/inmunología , Crotoxina/toxicidad , Estimulación Eléctrica , Electroforesis en Gel de Poliacrilamida , Heparina/uso terapéutico , Inmunoglobulina G/sangre , Inmunoglobulina G/aislamiento & purificación , Técnicas In Vitro , Inyecciones Subcutáneas , Masculino , Ratones , Músculo Esquelético/patología , Músculo Esquelético/fisiología , Bloqueo Neuromuscular , Unión Neuromuscular/efectos de los fármacos , Unión Neuromuscular/patología , Unión Neuromuscular/fisiología , Pruebas de Neutralización , Nervio Frénico/fisiología , Conejos , Factores de TiempoRESUMEN
A fibrinogen-clotting enzyme from the venom of the Peruvian bushmaster snake was purified to homogeneity by gel filtration on Sephadex G-100 followed by DEAE-cellulose ion-exchange chromatography using a linear ionic strength gradient with NaCl. The specific activity of the enzyme was 866 NIH U/mg, representing a 55-fold purification, with a recovery of 45%. The amino acid composition was Asx30, Thr14, Ser15, Glx33, Pro23, Gly22, Ala15, Val22, Cys18, Met3, Ile18, Leu23, Tyr2, Phe13, His8, Lys11, Arg11. The total carbohydrate content was 13.4%, comprised of 3.4% hexose, 8.7% hexosamine and 1.3% sialic acid. The enzyme was active against the synthetic amide substrate alpha-N-benzoyl-DL-arginine-p-nitroanilide (BAPNA) and against the ester substrates alpha-N-benzoyl-L-arginine ethyl ester (BAEE) and tosyl-L-arginine methyl ester (TAME). Kinetic parameters for TAME esterolysis were: Vmax, 135 mumoles/min/mg and Km, 2.5 x 10(-4) M. The pH optimum was 8.0. Vmax for BAPNA amidolysis was 0.363 mumoles/min/mg and Km, 7.5 x 10(-5) M. Enzyme activity was reduced by diethylpyrocarbonate and by photo-oxidation, suggesting that the enzyme is a serine protease with a histidine residue involved in the active site. The enzyme released fibrinopeptide A rapidly from purified human fibrinogen and fibrinopeptide B more slowly. Factor XIII was not activated and the clotting activity was not inhibited by heparin. A dose of 50 micrograms/kg brought about defibrinogenation in anaesthetized rats but rabbits were unaffected. A dose of 80 micrograms/kg defibrinogenated conscious rats after 5 hr. There were no hypotensive or haemorrhagic effects.
Asunto(s)
Venenos de Crotálidos/análisis , Serina Endopeptidasas/aislamiento & purificación , Aminoácidos/análisis , Animales , Coagulación Sanguínea/efectos de los fármacos , Cromatografía en Gel , Cromatografía por Intercambio Iónico , Venenos de Crotálidos/farmacología , Electroforesis en Gel de Poliacrilamida , Cinética , Masculino , Peso Molecular , Ratas , Ratas Endogámicas , Serina Endopeptidasas/análisisRESUMEN
The effect of Philodryas olfersii Duvernoy's secretion was studied in vivo in mice and chicks as well as in the mouse phrenic nerve-diaphragm and the chick biventer cervicis preparations. The whole secretion (20-40 micrograms/ml) increased the creatine kinase (CK) levels in mice but had no effect on the mouse phrenic nerve-diaphragm preparation. In the chick, the secretion caused head drop and paresia as well as irreversible blockade of the twitch-tension evoked by indirect stimulation in the chick biventer cervicis preparation (50% paralysis in 34.5 +/- 2.7 min, n = 4). The secretion also caused muscle contracture (30% of the maximal twitch-tension generated) after a latency of nearly 9 min. Following fractionation on a Superose 12 FPLC column, the neuromuscular activity was recovered in the high mol. wt fraction (Peak I). At a concentration of 10 micrograms/ml in the chick biventer cervicis preparation, Peak I caused 50% paralysis within 18.5 +/- 3.0 min (n = 4), and evoked a strong contracture (70% of the maximal twitch-tension generated). The contractile responses of the chick preparation to ACh and KCL were partially blocked (90%) by the whole secretion and totally blocked by Peak I. CK release was increased by the whole secretion but not by Peak I. The whole secretion also produced various degrees of muscle cell lysis and extensive widening of the intercellular spaces. The latter showed a loosely arranged membranous network. In general, Peak I caused only minor morphological alterations compared with the whole secretion, although these were still significantly different from those observed in the control preparations. The changes principally involved hypercontraction of the muscle fibers. Based on the above results, we conclude that Peak I contains the factor(s) responsible for the in vitro effects on neuromuscular transmission, whereas the direct myotoxic effect is apparently caused by at least one other component of the Duvernoy's secretion.
Asunto(s)
Colubridae , Músculo Esquelético/efectos de los fármacos , Unión Neuromuscular/efectos de los fármacos , Venenos de Serpiente/toxicidad , Animales , Pollos , Cromatografía en Gel , Cromatografía Líquida de Alta Presión , Creatina Quinasa/metabolismo , Diafragma , Relación Dosis-Respuesta a Droga , Glándulas Exocrinas , Masculino , Ratones , Músculo Esquelético/citología , Músculo Esquelético/patología , Adhesión en Parafina , Nervio Frénico , Mordeduras de Serpientes/fisiopatología , Venenos de Serpiente/metabolismoRESUMEN
A myotoxin has been isolated from the Duvernoy's gland (DG) secretion of the xenodontine colubrid Philodrvas olfersii (green snake) by gel filtration on Sephadex G-100 SF. Under non-reducing and reducing conditions in SDS-PAGE, the myotoxin migrates as a single band with a mol. wt. of 20000. The toxin has 182 amino acid residues (approximately 20% acidic), a pI of 4.8 and a blocked N-terminal. In the chick biventer cervicis preparation, P. olfersii myotoxin partially blocks potassium-evoked contractures without affecting either the twitch-tension resulting from indirect stimulation or the contractures evoked by acetylcholine. Both the DG secretion and the myotoxin increase the serum creatine kinase (CK) levels of mice and stimulate the release of CK from the biventer cervicis preparation in a dose- and time-dependent manner. The varying degrees of muscle cell lysis and extensive widening of the intercellular spaces caused by the DG secretion are reproduced by the myotoxin, with the exception that in the latter the partial or total loss of transverse muscle striations is restricted to the muscle periphery. This myotoxin is the first such protein to be characterized from a DG secretion.