Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 33
Filtrar
1.
Molecules ; 22(10)2017 Sep 25.
Artigo em Inglês | MEDLINE | ID: mdl-28946655

RESUMO

Violacein is an indole compound, produced by Chromobacterium violaceum, a bacteria present in tropical and subtropical areas. Among its numerous biological activities, its antimicrobial potential stands out. This study aims to determine the antimicrobial activity of VIO on S. aureus in planktonic culture and biofilms. VIO showed excellent antimicrobial activity in inhibiting and killing S. aureus in planktonic cultures and biofilm formation. The minimum bactericidal concentration (5 µg/mL) of VIO caused the death of S. aureus after 3-4 h of exposure and the minimum inhibitory concentration (1.25 µg/mL) of VIO inhibited bacterial growth within the first 8 h of contact. Biofilm formation was also strongly inhibited by VIO (1.25 µg/mL), in contrast to the higher resistance verified for S. aureus in mature biofilm (40 µg/mL). The high bacterial metabolic activity favored VIO activity; however, the good activity observed during phases of reduced metabolism indicates that VIO action involves more than one mechanism. Thus, VIO is a promising molecule for the development of an antimicrobial drug for the eradication of S. aureus infections.


Assuntos
Anti-Infecciosos/farmacologia , Biofilmes/efeitos dos fármacos , Indóis/farmacologia , Plâncton/efeitos dos fármacos , Staphylococcus aureus/efeitos dos fármacos , Testes de Sensibilidade Microbiana
2.
Biochim Biophys Acta ; 1820(7): 1128-40, 2012 Jul.
Artigo em Inglês | MEDLINE | ID: mdl-23077739

RESUMO

BACKGROUND: Peroxiredoxins have diverse functions in cellular defense-signaling pathways. 2-Cys-peroxiredoxins (2-Cys-Prx) reduce H2O2 and alkyl-hydroperoxide. This study describes the purification and characterization of a genuine 2-Cys-Prx from Vigna unguiculata (Vu-2-Cys-Prx). METHODS: Vu-2-Cys-Prx was purified from leaves by ammonium sulfate fractionation, chitin affinity and ion exchange chromatography. RESULTS: Vu-2-Cys-Prx reduces H2O2 using NADPH and DTT. Vu-2-Cys-Prx is a 44 kDa (SDS-PAGE)/46 kDa (exclusion chromatography) protein that appears as a 22 kDa molecule under reducing conditions, indicating that it is a homodimer linked intermolecularly by disulfide bonds and has a pI range of 4.56­4.72; its NH2-terminal sequence was similar to 2-Cys-Prx from Phaseolus vulgaris (96%) and Populus tricocarpa (96%). Analysis by ESI-Q-TOF MS/MS showed a molecular mass/pI of 28.622 kDa/5.18. Vu-2-Cys-Prx has 8% α-helix, 39% ß-sheet, 22% of turns and 31% of unordered forms. Vu-2-Cys-Prx was heat stable, has optimal activity at pH 7.0, and prevented plasmid DNA degradation. Atomic force microscopy shows that Vu-2-Cys-Prx oligomerized in decamers which might be associated with its molecular chaperone activity that prevented denaturation of insulin and citrate synthase. Its cDNA analysis showed that the redox-active Cys52 residue and the amino acids Pro45, Thr49 and Arg128 are conserved as in other 2-Cys-Prx. GENERAL SIGNIFICANCE: The biochemical and molecular features of Vu-2-Cys-Prx are similar to other members of 2-Cys-Prx family. To date, only one publication reported on the purification of native 2-Cys-Prx from leaves and the subsequent analysis by N-terminal Edman sequencing, which is crucial for construction of stromal recombinant 2-Cys-Prx proteins.


Assuntos
Antioxidantes/metabolismo , Cisteína/química , Fabaceae/metabolismo , Chaperonas Moleculares/metabolismo , Peroxirredoxinas/isolamento & purificação , Peroxirredoxinas/metabolismo , Folhas de Planta/metabolismo , Sequência de Aminoácidos , Eletroforese em Gel Bidimensional , Eletroforese em Gel de Poliacrilamida , Fabaceae/crescimento & desenvolvimento , Peróxido de Hidrogênio/metabolismo , Concentração de Íons de Hidrogênio , Microscopia de Força Atômica , Dados de Sequência Molecular , Oxirredução , Folhas de Planta/crescimento & desenvolvimento , Homologia de Sequência de Aminoácidos , Espectrometria de Massas em Tandem
3.
Int J Biol Macromol ; 252: 126529, 2023 Dec 01.
Artigo em Inglês | MEDLINE | ID: mdl-37633557

RESUMO

Although latex fluids are found in >20,000 plant species, the biochemical composition and biological function of their proteins are still poorly explored. Thus, this work aimed to conduct a proteomic analysis of Cryptostegia grandiflora latex (CgLP) for subsequent purification and characterization of an antifungal protein. After 2D-SDS-PAGE and mass spectrometry, 27 proteins were identified in CgLP, including a polygalacturonase inhibitor, cysteine peptidases, pathogenesis-related proteins (PR-4), and osmotins. Then, two osmotin isoforms (CgOsm) were purified, and a unique N-terminal sequence was determined (1ATFDIRSNCPYTVWAAAVPGGGRRLDRGQTWTINVAPGTA40). The PCR products revealed a cDNA sequence of 609 nucleotides for CgOsm, which encoded a polypeptide with 203 amino acid residues. The structure of CgOsm has features of typical osmotin or thaumatin-like proteins (TLPs), such as 16 conserved Cys residues, REDDD and FF motifs, an acidic cleft, and three main domains. Atomic force microscopy (AFM) and bioinformatics suggested that CgOsm is associated with three chain units. This result was interesting since the literature describes osmotins and TLPs as monomers. AFM also showed that Fusarium falciforme spores treated with CgOsm were drastically damaged. Therefore, it is speculated that CgOsm forms pores in the membrane of these cells, causing the leakage of cytoplasmic content.


Assuntos
Apocynaceae , Látex , Látex/química , Proteômica , Proteínas de Plantas/química , Isoformas de Proteínas/genética , Apocynaceae/química
4.
J Clin Microbiol ; 50(10): 3349-52, 2012 Oct.
Artigo em Inglês | MEDLINE | ID: mdl-22814457

RESUMO

The aim of this work was to catalog the clinical and ecoepidemiological characteristics of melioidosis in Brazil. The clinical-epidemiological features of melioidosis in Ceará are similar to those in other regions where the disease is endemic. These findings support the inclusion of this Brazilian state as part of the zone of endemicity for melioidosis.


Assuntos
Doenças Endêmicas , Melioidose/epidemiologia , Melioidose/patologia , Adolescente , Adulto , Idoso , Brasil/epidemiologia , Criança , Feminino , Humanos , Masculino , Pessoa de Meia-Idade , Topografia Médica
5.
Water Environ Res ; 84(3): 274-81, 2012 Mar.
Artigo em Inglês | MEDLINE | ID: mdl-22755495

RESUMO

This paper describes the phenotypic and genotypic diversity of a Gram-positive, aerobic bacterial population isolated from the chlorine tank of a wastewater treatment plant. A total of 12 sporeforming, rod-shaped isolates were identified using 16S rRNA gene sequencing and biochemical tests. Pairwise genetic comparisons revealed the identity among sequences obtained from isolates varied from 92.6 to 100%. Similarity searches on GenBank showed that five strains were closely related (99 to 100% identity) to Bacillus subtilis and two were almost identical (99%) to B. megaterium and B. licheniformis. Because the five remaining strains were either closely related (97 to 99% identity) or identical to B. cereus, B. thuringiensis, and B. anthracis, they were classified as belonging to the B. cereus group. Apart from one strain, all clades in the phylogenetic tree were identical to clusters formed in the dendrogram based on biochemical tests results. According to the biochemical profiles, all isolates were characterized as different strains. In addition to chlorine resistance, all isolates were found to be resistant to at least one of five antibiotics tested. These results identify the potential risk of spreading antibiotic resistance genes in the environment by chlorine-resistant strains of Bacillus.


Assuntos
Bacillus/isolamento & purificação , Cloro/farmacologia , Desinfecção , Farmacorresistência Bacteriana , Eliminação de Resíduos Líquidos , Microbiologia da Água , Bacillus/classificação , Bacillus/efeitos dos fármacos , Filogenia , Purificação da Água
6.
Phytochemistry ; 169: 112163, 2020 Jan.
Artigo em Inglês | MEDLINE | ID: mdl-31605904

RESUMO

Cysteine peptidases (EC 3.4.22) are the most abundant enzymes in latex fluids. However, their physiological functions are still poorly understood, mainly related to defense against phytopathogens. The present study reports the cDNA cloning and sequencing of five undescribed cysteine peptidases from Calotropis procera (Aiton) Dryand (Apocynaceae) as well as some in silico analyses. Of these, three cysteine peptidases (CpCP1, CpCP2, and CpCP3) were purified. Their enzymatic kinetics were determined and they were assayed for their efficacy in inhibiting the hyphal growth of phytopathogenic fungi. The mechanism of action was investigated by fluorescence and atomic force microscopy as well as by induction of reactive oxygen species (ROS). The deduced amino acid sequences showed similar biochemical characteristics and high sequence homology with several other papain-like cysteine peptidases. Three-dimensional models showed two typical cysteine peptidase domains (L and R domains), forming a "V-shaped" active site containing the catalytic triad (Cys, His, and Asn). Proteolysis of CpCP1 was higher at pH 7.0, whereas for CpCP2 and CpCP3 it was higher at 7.5. All peptidases exhibited optimum activity at 35 °C and followed Michaelis-Menten kinetics. However, the major difference among them was that CpCP1 exhibited highest Vmax, Km, Kcat and catalytic efficiency. All peptidases were deleterious to the two fungi tested, with IC50 of around 50 µg/mL. The peptidases promoted membrane permeabilization, morphological changes with leakage of cellular content, and induction of ROS in F. oxysporum spores. These results corroborate the hypothesis that latex cysteine peptidases play a role in defense against fungi.


Assuntos
Antifúngicos/farmacologia , Calotropis/enzimologia , Cisteína Proteases/metabolismo , Fusarium/efeitos dos fármacos , Sequência de Aminoácidos , Antifúngicos/química , Antifúngicos/metabolismo , Biocatálise , Cisteína Proteases/química , Cisteína Proteases/genética , Relação Dose-Resposta a Droga , Fusarium/metabolismo , Concentração de Íons de Hidrogênio , Testes de Sensibilidade Microbiana , Modelos Moleculares , Alinhamento de Sequência , Temperatura
7.
Protein Pept Lett ; 27(7): 593-603, 2020.
Artigo em Inglês | MEDLINE | ID: mdl-31994998

RESUMO

BACKGROUND: Osmotin-Like Proteins (OLPs) have been purified and characterized from different plant tissues, including latex fluids. Besides its defensive role, tobacco osmotin seems to induce adiponectin-like physiological effects, acting as an agonist. However, molecular information about this agonistic effect on adiponectin receptors has been poorly exploited and other osmotins have not been investigated yet. OBJECTIVE AND METHODS: The present study involved the characterization of three OLPs from Plumeria rubra latex and molecular docking studies to evaluate the interaction between them and adiponectin receptors (AdipoR1 and AdipoR2). RESULTS: P. rubra Osmotin-Like Proteins (PrOLPs) exhibited molecular masses from 21 to 25 kDa and isoelectric points ranging from 4.4 to 7.7. The proteins have 16 cysteine residues, which are involved in eight disulfide bonds, conserved in the same positions as other plant OLPs. The threedimensional (3D) models exhibited the three typical domains of OLPs, and molecular docking analysis showed that two PrOLP peptides interacted with two adiponectin receptors similarly to tobacco osmotin peptide. CONCLUSION: As observed for tobacco osmotin, the latex osmotins of P. rubra exhibited compatible interactions with adiponectin receptors. Therefore, these plant defense proteins (without known counterparts in humans) are potential tools to study modulation of glucose metabolism in type II diabetes, where adiponectin plays a pivotal role in homeostasis.


Assuntos
Adiponectina/química , Apocynaceae/química , Simulação de Acoplamento Molecular , Peptídeos/química , Peptidomiméticos/química , Proteínas de Plantas/química , Humanos , Receptores de Adiponectina/química
8.
Int J Biol Macromol ; 165(Pt A): 1482-1495, 2020 Dec 15.
Artigo em Inglês | MEDLINE | ID: mdl-33017605

RESUMO

A chitosanase (CvCsn46) from Chromobacterium violaceum ATCC 12472 was produced in Escherichia coli, purified, and partially characterized. When subjected to denaturing polyacrylamide gel electrophoresis, the enzyme migrated as two protein bands (38 and 36 kDa apparent molecular masses), which were both identified as CvCsn46 by mass spectrometry. The enzyme hydrolyzed colloidal chitosan, with optimum catalytic activity at 50 °C, and two optimum pH values (at pH 6.0 and pH 11.0). The chitosanolytic activity of CvCsn46 was enhanced by some ions (Ca2+, Co2+, Cu2+, Sr2+, Mn2+) and DTT, whereas Fe2+, SDS and ß-mercaptoethanol completely inhibited its activity. CvCsn46 showed a non-Michaelis-Menten kinetics, characterized by a sigmoidal velocity curve (R2 = 0.9927) and a Hill coefficient of 3.95. ESI-MS analysis revealed that the hydrolytic action of CvCsn46 on colloidal chitosan generated a mixture of low molecular mass chitooligosaccharides, containing from 2 to 7 hexose residues, as well as D-glucosamine. The chitosan oligomers generated by CvCsn46 inhibited in vitro the mycelial growth of Lasiodiplodia theobromae, significantly reducing mycelium extension and inducing hyphal morphological alterations, as observed by scanning electron microscopy. CvCsn46 was characterized as a versatile biocatalyst that produces well-defined chitooligosaccharides, which have potential to control fungi that cause important crop diseases.


Assuntos
Antifúngicos/química , Quitina/análogos & derivados , Chromobacterium/genética , Glicosídeo Hidrolases/genética , Sequência de Aminoácidos/genética , Quitina/biossíntese , Quitina/química , Quitina/genética , Quitosana/química , Chromobacterium/enzimologia , Escherichia coli/genética , Glicosídeo Hidrolases/biossíntese , Glicosídeo Hidrolases/química , Concentração de Íons de Hidrogênio , Hidrólise , Peso Molecular , Oligossacarídeos
9.
Phytochemistry ; 180: 112527, 2020 Dec.
Artigo em Inglês | MEDLINE | ID: mdl-33007618

RESUMO

A partial cDNA sequence from Anacardium occidentale CCP 76 was obtained, encoding a GH19 chitinase (AoChi) belonging to class VI. AoChi exhibits distinct structural features in relation to previously characterized plant GH19 chitinases from classes I, II, IV and VII. For example, a conserved Glu residue at the catalytic center of typical GH19 chitinases, which acts as the proton donor during catalysis, is replaced by a Lys residue in AoChi. To verify if AoChi is a genuine chitinase or is a chitinase-like protein that has lost its ability to degrade chitin and inhibit the growth of fungal pathogens, the recombinant protein was expressed in Pichia pastoris, purified and biochemically characterized. Purified AoChi (45 kDa apparent molecular mass) was able to degrade colloidal chitin, with optimum activity at pH 6.0 and at temperatures from 30 °C to 50 °C. AoChi activity was completely lost when the protein was heated at 70 °C for 1 h or incubated at pH values of 2.0 or 10.0. Several cation ions (Al3+, Cd2+, Ca2+, Pb2+, Cu2+, Fe3+, Mn2+, Rb+, Zn2+ and Hg2+), chelating (EDTA) and reducing agents (DTT, ß-mercaptoethanol) and the denaturant SDS, drastically reduced AoChi enzymatic activity. AoChi chitinase activity fitted the classical Michaelis-Menten kinetics, although turnover number and catalytic efficiency were much lower in comparison to typical GH19 plant chitinases. Moreover, AoChi inhibited in vitro the mycelial growth of Lasiodiplodia theobromae, causing several alterations in hyphae morphology. Molecular docking of a chito-oligosaccharide in the substrate-binding cleft of AoChi revealed that the Lys residue (theoretical pKa = 6.01) that replaces the catalytic Glu could act as the proton donor during catalysis.


Assuntos
Anacardium , Quitinases , Antifúngicos/farmacologia , Quitina , Quitinases/genética , Simulação de Acoplamento Molecular
10.
Food Chem ; 307: 125574, 2020 Mar 01.
Artigo em Inglês | MEDLINE | ID: mdl-31648178

RESUMO

This article reports the characterization and evaluation of the biotechnological potential of a cysteine protease purified from Calotropis procera (CpCP3). This enzyme was highly stable to different metal ions and was able to hydrolyze κ-casein similarly to bovine chymosin. Atomic force microscopy showed that the process of casein micelle aggregation induced by CpCP3 was similar to that caused by chymosin. The cheeses made using CpCP3 showed higher moisture content than those made with chymosin, but protein, fat, and ash were similar. The sensory analysis showed that cheeses made with CpCP3 had high acceptance index (>80%). In silico analysis predicted the presence of only two short allergenic peptides on the surface of CpCP3, which was highly susceptible to digestive enzymes and did not alter zebrafish embryos' morphology and development. Moreover, recombinant CpCP3 was expressed in Escherichia coli. All results support the biotechnological potential of CpCP3 as an alternative enzyme to chymosin.


Assuntos
Calotropis/enzimologia , Caseínas/metabolismo , Queijo , Cisteína Proteases/metabolismo , Animais , Bovinos , Quimosina/metabolismo , Hidrólise , Látex/metabolismo , Proteínas de Plantas/metabolismo
11.
Enzyme Microb Technol ; 126: 50-61, 2019 Jul.
Artigo em Inglês | MEDLINE | ID: mdl-31000164

RESUMO

The biocontrol activity of some soil strains of Chromobacterium sp. against pathogenic fungi has been attributed to secreted chitinases. The aim of this work was to characterize biochemically a recombinant chitinase (CvChi47) from C. violaceum ATCC 12472 and to investigate its effects on phytopathogenic fungi. CvChi47 is a modular enzyme with 450 amino acid residues, containing a type I signal peptide at the N-terminal region, followed by one catalytic domain belonging to family 18 of the glycoside hydrolases, and two type-3 chitin-binding domains at the C-terminal end. The recombinant enzyme was expressed in Escherichia coli as a His-tagged protein and purified to homogeneity. The native signal peptide of CvChi47 was used to direct its secretion into the culture medium, from where the recombinant product was purified by affinity chromatography on chitin and immobilized metal. The purified protein showed an apparent molecular mass of 46 kDa, as estimated by denaturing polyacrylamide gel electrophoresis, indicating the removal of the signal peptide. CvChi47 was a thermostable protein, retaining approximately 53.7% of its activity when heated at 100 °C for 1 h. The optimum hydrolytic activity was observed at 60 °C and pH 5. The recombinant chitinase inhibited the conidia germination of the phytopathogenic fungi Fusarium oxysporum and F. guttiforme, hence preventing mycelial growth. Furthermore, atomic force microscopy experiments revealed a pronounced morphological alteration of the cell surface of conidia incubated with CvChi47 in comparison to untreated cells. Taken together, these results show the potential of CvChi47 as a molecular tool to control plant diseases caused by these Fusarium species.


Assuntos
Antifúngicos/farmacologia , Quitinases/metabolismo , Chromobacterium/enzimologia , Fusarium/crescimento & desenvolvimento , Doenças das Plantas/prevenção & controle , Proteínas Recombinantes/metabolismo , Sequência de Aminoácidos , Domínio Catalítico , Quitinases/química , Quitinases/genética , Clonagem Molecular , Estabilidade Enzimática , Fusarium/efeitos dos fármacos , Doenças das Plantas/microbiologia , Conformação Proteica , Proteínas Recombinantes/química , Proteínas Recombinantes/genética , Homologia de Sequência , Esporos Fúngicos/efeitos dos fármacos , Esporos Fúngicos/crescimento & desenvolvimento , Temperatura
12.
Plant Physiol Biochem ; 140: 68-77, 2019 Jul.
Artigo em Inglês | MEDLINE | ID: mdl-31085448

RESUMO

Mo-CBP3 is a chitin-binding 2S albumin from Moringa oleifera. This seed storage protein is resistant to thermal denaturation and shows biological activities that might be of practical use, such as antifungal properties against Candida sp., a pathogen that causes candidiasis, and against Fusarium solani, a soil fungus that can cause diseases in plants and humans. Previous work has demonstrated that Mo-CBP3 is a mixture of isoforms encoded by members of a small multigene family. Mature Mo-CBP3 is a small protein (∼14 kDa), constituted by a small chain of approximately 4 kDa and a large chain of 8 kDa, which are held together by disulfide bridges. However, a more comprehensive picture on the spectrum of Mo-CBP3 isoforms which are found in mature seeds, is still lacking. In this work, genomic DNA fragments were obtained from M. oleifera leaves, cloned and completely sequenced, thus revealing new genes encoding Mo-CBP3. Moreover, mass spectrometry analysis showed that the mature protein is a complex mixture of isoforms with a remarkable number of molecular mass variants. Using computational predictions and calculations, most (∼86%) of the experimentally determined masses were assigned to amino acid sequences deduced from DNA fragments. The results suggested that the complex mixture of Mo-CBP3 isoforms originates from proteins encoded by closely related genes, whose products undergo different combinations of distinct post-translational modifications, including cleavage at the N- and C-terminal ends of both subunits, cyclization of N-terminal Gln, as well as Pro hydroxylation, Ser/Thr phosphorylation, and Met oxidation.


Assuntos
Moringa oleifera/química , Proteínas de Plantas/metabolismo , Isoformas de Proteínas/metabolismo , Humanos , Proteínas de Plantas/química , Isoformas de Proteínas/química , Processamento de Proteína Pós-Traducional
13.
Int J Biol Macromol ; 126: 1167-1176, 2019 Apr 01.
Artigo em Inglês | MEDLINE | ID: mdl-30625353

RESUMO

The germin-like protein (GLP) purified from Thevetia peruviana, Peruvianin-I, is the only one described as having proteolytic activity. Therefore, the goal of this study was to investigate the structural features responsible for its enzymatic activity. Although the amino acid sequence of Peruvianin-I showed high identity with other GLPs, it exhibited punctual mutations, which were responsible for the absence of oxalate oxidase activity. The phylogenetic analysis showed that Peruvianin-I does not belong to any classification of GLP subfamilies. Moreover, Peruvianin-I contains a catalytic triad found in all plant cysteine peptidases. Molecular docking simulations confirmed the role of the catalytic triad in its proteolytic activity. Synchrotron radiation circular dichroism assays confirmed that Peruvianin-I was stable at pH ranging from 5.0 to 8.0 and that it presented significant structural changes only above 60 °C. The addition of iodoacetamide caused changes in its native conformation, but only a slight effect was observed after adding a reducing agent. This study reports an unusual protein with germin-like structure, lacking typical oxalate oxidase activity. Instead, the proteolytic activity observed suggests that the protein is a cysteine peptidase. These structural peculiarities make Peruvianin­I an interesting model for further understanding of the action of laticifer fluids in plant defense.


Assuntos
Glicoproteínas/química , Glicoproteínas/metabolismo , Proteínas de Plantas/química , Proteínas de Plantas/metabolismo , Proteólise , Thevetia/enzimologia , Sequência de Aminoácidos , Domínio Catalítico , Dicroísmo Circular , Concentração de Íons de Hidrogênio , Simulação de Acoplamento Molecular , Oxirredutases/metabolismo , Filogenia , Inibidores de Proteases/farmacologia , Substâncias Redutoras/química , Análise de Sequência de Proteína , Especificidade por Substrato/efeitos dos fármacos , Temperatura
14.
Int J Biol Macromol ; 117: 565-573, 2018 Oct 01.
Artigo em Inglês | MEDLINE | ID: mdl-29847781

RESUMO

Vicilins are 7S globulins which constitute the major seed storage proteins in leguminous species. Variant vicilins showing differential binding affinities for chitin have been implicated in the resistance and susceptibility of cowpea to the bruchid Callosobruchus maculatus. These proteins are members of the cupin superfamily, which includes a wide variety of enzymes and non-catalytic seed storage proteins. The cupin fold does not share similarity with any known chitin-biding domain. Therefore, it is poorly understood how these storage proteins bind to chitin. In this work, partial cDNA sequences encoding ß-vignin, the major component of cowpea vicilins, were obtained from developing seeds. Three-dimensional molecular models of ß-vignin showed the characteristic cupin fold and computational simulations revealed that each vicilin trimer contained 3 chitin-binding sites. Interaction models showed that chito-oligosaccharides bound to ß-vignin were stabilized mainly by hydrogen bonds, a common structural feature of typical carbohydrate-binding proteins. Furthermore, many of the residues involved in the chitin-binding sites of ß-vignin are conserved in other 7S globulins. These results support previous experimental evidences on the ability of vicilin-like proteins from cowpea and other leguminous species to bind in vitro to chitin as well as in vivo to chitinous structures of larval C. maculatus midgut.


Assuntos
Proteínas de Plantas/genética , Proteínas de Armazenamento de Sementes/genética , Vigna/genética , Animais , Sítios de Ligação , Quitina/química , Quitina/genética , Clonagem Molecular , Besouros/patogenicidade , DNA Complementar/genética , Resistência à Doença/genética , Doenças das Plantas/genética , Doenças das Plantas/parasitologia , Proteínas de Plantas/química , Ligação Proteica , Proteínas de Armazenamento de Sementes/química , Sementes/química , Sementes/genética , Vigna/crescimento & desenvolvimento
15.
Phytochemistry ; 139: 60-71, 2017 Jul.
Artigo em Inglês | MEDLINE | ID: mdl-28414935

RESUMO

The genus Swartzia is a member of the tribe Swartzieae, whose genera constitute the living descendants of one of the early branches of the papilionoid legumes. Legume lectins comprise one of the main families of structurally and evolutionarily related carbohydrate-binding proteins of plant origin. However, these proteins have been poorly investigated in Swartzia and to date, only the lectin from S. laevicarpa seeds (SLL) has been purified. Moreover, no sequence information is known from lectins of any member of the tribe Swartzieae. In the present study, partial cDNA sequences encoding L-type lectins were obtained from developing seeds of S. simplex var. grandiflora. The amino acid sequences of the S. simplex grandiflora lectins (SSGLs) were only averagely related to the known primary structures of legume lectins, with sequence identities not greater than 50-52%. The SSGL sequences were more related to amino acid sequences of papilionoid lectins from members of the tribes Sophoreae and Dalbergieae and from the Cladratis and Vataireoid clades, which constitute with other taxa, the first branching lineages of the subfamily Papilionoideae. The three-dimensional structures of 2 representative SSGLs (SSGL-A and SSGL-E) were predicted by homology modeling using templates that exhibit the characteristic ß-sandwich fold of the L-type lectins. Molecular docking calculations predicted that SSGL-A is able to interact with D-galactose, N-acetyl-D-galactosamine and α-lactose, whereas SSGL-E is probably a non-functional lectin due to 2 mutations in the carbohydrate-binding site. Using molecular dynamics simulations followed by density functional theory calculations, the binding free energies of the interaction of SSGL-A with GalNAc and α-lactose were estimated as -31.7 and -47.5 kcal/mol, respectively. These findings gave insights about the carbohydrate-binding specificity of SLL, which binds to immobilized lactose but is not retained in a matrix containing D-GalNAc as ligand.


Assuntos
DNA Complementar/genética , Fabaceae/genética , Lectinas Tipo C/genética , Lectinas de Plantas/genética , Sequência de Aminoácidos , Carboidratos/análise , Fabaceae/química , Galactose/metabolismo , Humanos , Modelos Moleculares , Simulação de Acoplamento Molecular , Dados de Sequência Molecular , Grupos Populacionais , Sementes/química
16.
Biochimie ; 135: 89-103, 2017 Apr.
Artigo em Inglês | MEDLINE | ID: mdl-28153694

RESUMO

A cowpea class I chitinase (VuChiI) was expressed in the methylotrophic yeast P. pastoris. The recombinant protein was secreted into the culture medium and purified by affinity chromatography on a chitin matrix. The purified chitinase migrated on SDS-polyacrylamide gel electrophoresis as two closely-related bands with apparent molecular masses of 34 and 37 kDa. The identity of these bands as VuChiI was demonstrated by mass spectrometry analysis of tryptic peptides and N-terminal amino acid sequencing. The recombinant chitinase was able to hydrolyze colloidal chitin but did not exhibit enzymatic activity toward synthetic substrates. The highest hydrolytic activity of the cowpea chitinase toward colloidal chitin was observed at pH 5.0. Furthermore, most VuChiI activity (approximately 92%) was retained after heating to 50 °C for 30 min, whereas treatment with 5 mM Cu2+ caused a reduction of 67% in the enzyme's chitinolytic activity. The recombinant protein had antifungal activity as revealed by its ability to inhibit the spore germination and mycelial growth of Penicillium herquei. The three-dimensional structure of VuChiI was resolved at a resolution of 1.55 Å by molecular replacement. The refined model had 245 amino acid residues and 381 water molecules, and the final R-factor and Rfree values were 14.78 and 17.22%, respectively. The catalytic domain of VuChiI adopts an α-helix-rich fold, stabilized by 3 disulfide bridges and possessing a wide catalytic cleft. Analysis of the crystallographic model and molecular docking calculations using chito-oligosaccharides provided evidences about the VuChiI residues involved in sugar binding and catalysis, and a possible mechanism of antifungal action is suggested.


Assuntos
Antifúngicos/metabolismo , Quitinases/metabolismo , Pichia/enzimologia , Proteínas de Plantas/metabolismo , Vigna/enzimologia , Antifúngicos/química , Antifúngicos/farmacologia , Quitinases/química , Quitinases/farmacologia , Hidrólise , Penicillium/efeitos dos fármacos , Proteínas de Plantas/química , Proteínas de Plantas/farmacologia , Ligação Proteica
17.
Front Microbiol ; 8: 980, 2017.
Artigo em Inglês | MEDLINE | ID: mdl-28634471

RESUMO

Candida species are opportunistic pathogens that infect immunocompromised and/or immunosuppressed patients, particularly in hospital facilities, that besides representing a significant threat to health increase the risk of mortality. Apart from echinocandins and triazoles, which are well tolerated, most of the antifungal drugs used for candidiasis treatment can cause side effects and lead to the development of resistant strains. A promising alternative to the conventional treatments is the use of plant proteins. M. oleifera Lam. is a plant with valuable medicinal properties, including antimicrobial activity. This work aimed to purify a chitin-binding protein from M. oleifera seeds and to evaluate its antifungal properties against Candida species. The purified protein, named Mo-CBP2, represented about 0.2% of the total seed protein and appeared as a single band on native PAGE. By mass spectrometry, Mo-CBP2 presented 13,309 Da. However, by SDS-PAGE, Mo-CBP2 migrated as a single band with an apparent molecular mass of 23,400 Da. Tricine-SDS-PAGE of Mo-CBP2 under reduced conditions revealed two protein bands with apparent molecular masses of 7,900 and 4,600 Da. Altogether, these results suggest that Mo-CBP2 exists in different oligomeric forms. Moreover, Mo-CBP2 is a basic glycoprotein (pI 10.9) with 4.1% (m/m) sugar and it did not display hemagglutinating and hemolytic activities upon rabbit and human erythrocytes. A comparative analysis of the sequence of triptic peptides from Mo-CBP2 in solution, after LC-ESI-MS/MS, revealed similarity with other M. oleifera proteins, as the 2S albumin Mo-CBP3 and flocculating proteins, and 2S albumins from different species. Mo-CBP2 possesses in vitro antifungal activity against Candida albicans, C. parapsilosis, C. krusei, and C. tropicalis, with MIC50 and MIC90 values ranging between 9.45-37.90 and 155.84-260.29 µM, respectively. In addition, Mo-CBP2 (18.90 µM) increased the cell membrane permeabilization and reactive oxygen species production in C. albicans and promoted degradation of circular plasmid DNA (pUC18) from Escherichia coli. The data presented in this study highlight the potential use of Mo-CBP2 as an anticandidal agent, based on its ability to inhibit Candida spp. growth with apparently low toxicity on mammalian cells.

18.
J Agric Food Chem ; 53(16): 6414-9, 2005 Aug 10.
Artigo em Inglês | MEDLINE | ID: mdl-16076127

RESUMO

A lectin was purified from the seaweed Gracilaria cornea by hydrophobic interaction chromatography on phenyl-Sepharose CL-4B followed by affinity chromatography on immobilized mucin. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis of G. cornea lectin (GCL) revealed a single protein band of approximately 60 kDa, whereas by gel filtration on Sephadex G-100 its native molecular mass was 66 kDa. GCL exhibited a single isoeletric point of 4.3 and a 52.5% content of neutral sugars. Furthermore, the EDTA-treated lectin did not show any significant decrease in its ability to agglutinate trypsin-treated chicken erythrocytes. These data suggest that GCL is an acidic, monomeric glycoprotein that probably does not require divalent metal ions for its hemagglutinating activity. GCL hemagglutinating activity was not inhibited by any of the mono-, di-, and trisaccharides tested but was by the complex glycoproteins fetuin and porcine stomach mucin. Exposure of engorged females of the cattle tick (Boophilus microplus) to 0.1 mg mL(-1) GCL significantly (P < 0.05) reduced the female weight after the oviposition period, the egg mass weight, the hatching period, and the mean larvae survival time.


Assuntos
Gracilaria/química , Ixodidae/fisiologia , Lectinas/isolamento & purificação , Lectinas/farmacologia , Animais , Galinhas/sangue , Feminino , Hemaglutinação/efeitos dos fármacos , Humanos , Inseticidas , Ixodidae/crescimento & desenvolvimento , Lectinas/química , Coelhos
19.
Food Chem Toxicol ; 83: 1-9, 2015 Sep.
Artigo em Inglês | MEDLINE | ID: mdl-26032632

RESUMO

Mo-CBP3 is an antifungal protein produced by Moringa oleifera which has been investigated as potential candidate for developing transgenic crops. Before the use of novel proteins, food safety tests must be conducted. This work represents an early food safety assessment of Mo-CBP3, using the two-tiered approach proposed by ILSI. The history of safe use, mode of action and results for amino acid sequence homology using the full-length and short contiguous amino acids sequences indicate low risk associated to this protein. Mo-CBP3 isoforms presented a reasonable number of alignments (>35% identity) with allergens in a window of 80 amino acids. This protein was resistant to pepsin degradation up to 2 h, but it was susceptible to digestion using pancreatin. Many positive attributes were presented for Mo-CBP3. However, this protein showed high sequence homology with allergens and resistance to pepsin digestion that indicates that further hypothesis-based testing on its potential allergenicity must be done. Additionally, animal toxicity evaluations (e.g. acute and repeated dose oral exposure assays) must be performed to meet the mandatory requirements of several regulatory agencies. Finally, the approach adopted here exemplified the importance of performing an early risk assessment of candidate proteins for use in plant transformation programs.


Assuntos
Antígenos de Plantas/efeitos adversos , Proteínas Alimentares/efeitos adversos , Alimentos Geneticamente Modificados/efeitos adversos , Modelos Moleculares , Moringa oleifera/metabolismo , Proteínas de Plantas/efeitos adversos , Sementes/metabolismo , Alérgenos/efeitos adversos , Alérgenos/química , Alérgenos/genética , Alérgenos/metabolismo , Ração Animal/efeitos adversos , Ração Animal/microbiologia , Animais , Antígenos de Plantas/química , Antígenos de Plantas/genética , Antígenos de Plantas/metabolismo , Brasil , Quitina/metabolismo , Proteínas Alimentares/química , Proteínas Alimentares/metabolismo , Digestão , Hipersensibilidade Alimentar/etiologia , Hipersensibilidade Alimentar/prevenção & controle , Alimentos Geneticamente Modificados/microbiologia , Humanos , Ligantes , Fungos Mitospóricos/crescimento & desenvolvimento , Moringa oleifera/genética , Controle Biológico de Vetores/métodos , Proteínas de Plantas/química , Proteínas de Plantas/genética , Proteínas de Plantas/metabolismo , Plantas Geneticamente Modificadas/efeitos adversos , Plantas Geneticamente Modificadas/genética , Plantas Geneticamente Modificadas/metabolismo , Isoformas de Proteínas/efeitos adversos , Isoformas de Proteínas/química , Isoformas de Proteínas/genética , Isoformas de Proteínas/metabolismo , Medição de Risco , Sementes/genética , Homologia de Sequência de Aminoácidos
20.
PLoS One ; 10(3): e0119871, 2015.
Artigo em Inglês | MEDLINE | ID: mdl-25789746

RESUMO

Mo-CBP3 is a chitin-binding protein from M. oleifera seeds that inhibits the germination and mycelial growth of phytopathogenic fungi. This protein is highly thermostable and resistant to pH changes, and therefore may be useful in the development of new antifungal drugs. However, the relationship of MoCBP3 with the known families of carbohydrate-binding domains has not been established. In the present study, full-length cDNAs encoding 4 isoforms of Mo-CBP3 (Mo-CBP3-1, Mo-CBP3-2, Mo-CBP3-3 and Mo-CBP3-4) were cloned from developing seeds. The polypeptides encoded by the Mo-CBP3 cDNAs were predicted to contain 160 (Mo-CBP3-3) and 163 amino acid residues (Mo-CBP3-1, Mo-CBP3-2 and Mo-CBP3-4) with a signal peptide of 20-residues at the N-terminal region. A comparative analysis of the deduced amino acid sequences revealed that Mo-CBP3 is a typical member of the 2S albumin family, as shown by the presence of an eight-cysteine motif, which is a characteristic feature of the prolamin superfamily. Furthermore, mass spectrometry analysis demonstrated that Mo-CBP3 is a mixture of isoforms that correspond to different mRNA products. The identification of Mo-CBP3 as a genuine member of the 2S albumin family reinforces the hypothesis that these seed storage proteins are involved in plant defense. Moreover, the chitin-binding ability of Mo-CBP3 reveals a novel functionality for a typical 2S albumin.


Assuntos
Albuminas 2S de Plantas/genética , Proteínas de Transporte/genética , Quitinases/genética , Moringa oleifera/genética , Proteínas de Plantas/genética , Albuminas 2S de Plantas/metabolismo , Sequência de Aminoácidos , Proteínas de Transporte/metabolismo , Quitina/genética , Quitina/metabolismo , Quitinases/classificação , Sementes/química , Sementes/genética
SELEÇÃO DE REFERÊNCIAS
Detalhe da pesquisa