Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 23
Filtrar
1.
Photochem Photobiol Sci ; 19(12): 1750-1764, 2020 Dec 01.
Artigo em Inglês | MEDLINE | ID: mdl-33241249

RESUMO

Firefly luciferases usually emit green-yellow bioluminescence at physiological pH values. However, under acidic conditions, in the presence of heavy metals and, at high temperatures they emit red bioluminescence. To understand the structural origin of bioluminescence colors and pH-sensitivity, about 20 firefly luciferases have been cloned, sequenced and investigated. The proton and metal-binding site responsible for pH- and metal sensitivity in firefly luciferases was shown to involve the residues H310, E311 and E354 in firefly luciferases. However, it is still unclear how and why pH-sensitivity arose and evolved in firefly luciferases. Here, we cloned and characterized two novel luciferase cDNAs from the fat body and lanterns of the Brazilian firefly Aspisoma lineatum. The larval fat body isozyme (AL2) has 545 residues, and displays very slow luminescence kinetics and a pH-insensitive spectrum. The adult lantern isozyme (AL1) has 548 residues, displays flash-like kinetics and pH and metal sensitive bioluminescence spectra, and is at least 10 times catalytically more efficient than AL2. Thermostability and CD studies showed that AL2 is much more stable and rigid than the AL1 isozyme. Multialignment and modelling studies show that the E310Q substitution (E310 in AL2 and Q310 in AL1) may have been critical for the origin of pH-sensitivity in firefly luciferases. The results indicate that the lantern efficient flash-emitting pH-sensitive luciferases arose from less efficient glow-type pH-insensitive luciferases found in the fat body of ancestral larval fireflies by enzyme structure flexibilization and substitution at position 310.


Assuntos
Corpo Adiposo/enzimologia , Vaga-Lumes/enzimologia , Luciferases de Vaga-Lume/metabolismo , Animais , Concentração de Íons de Hidrogênio , Reprodução
2.
Biochim Biophys Acta ; 1861(9 Pt A): 970-979, 2016 09.
Artigo em Inglês | MEDLINE | ID: mdl-27233517

RESUMO

Brown spider phospholipases D from Loxosceles venoms are among the most widely studied toxins since they induce dermonecrosis, triggering inflammatory responses, increase vascular permeability, cause hemolysis, and renal failure. The catalytic (H12 and H47) and metal-ion binding (E32 and D34) residues in Loxosceles intermedia phospholipase D (LiRecDT1) were mutated to understand their roles in the observed activities. All mutants were identified using whole venom serum antibodies and a specific antibody to wild-type LiRecDT1, they were also analyzed by circular dichroism (CD) and differential scanning calorimetry (DSC). The phospholipase D activities of H12A, H47A, H12A-H47A, E32, D34 and E32A-D34A, such as vascular permeability, dermonecrosis, and hemolytic effects were inhibited. The mutant Y228A was equally detrimental to biochemical and biological effects of phospholipase D, suggesting an essential role of this residue in substrate recognition and binding. On the other hand, the mutant C53A-C201A reduced the enzyme's ability to hydrolyze phospholipids and promote dermonecrosis, hemolytic, and vascular effects. These results provide the basis understanding the importance of specific residues in the observed activities and contribute to the design of synthetic and specific inhibitors for Brown spider venom phospholipases D.


Assuntos
Domínio Catalítico/genética , Fosfolipase D/química , Fosfolipídeos/química , Venenos de Aranha/enzimologia , Animais , Aranha Marrom Reclusa/química , Aranha Marrom Reclusa/enzimologia , Permeabilidade Capilar , Dicroísmo Circular , Hemólise , Mutação , Fosfolipase D/metabolismo , Fosfolipídeos/metabolismo , Diester Fosfórico Hidrolases/química , Venenos de Aranha/química
3.
Photochem Photobiol Sci ; 15(5): 654-65, 2016 05 11.
Artigo em Inglês | MEDLINE | ID: mdl-27101527

RESUMO

Beetle luciferases, the enzymes responsible for bioluminescence, are special cases of CoA-ligases which have acquired a novel oxygenase activity, offering elegant models to investigate the structural origin of novel catalytic functions in enzymes. What the original function of their ancestors was, and how the new oxygenase function emerged leading to bioluminescence remains unclear. To address these questions, we solved the crystal structure of a recently cloned Malpighian luciferase-like enzyme of unknown function from Zophobas morio mealworms, which displays weak luminescence with ATP and the xenobiotic firefly d-luciferin. The three dimensional structure of the N-terminal domain showed the expected general fold of CoA-ligases, with a unique carboxylic substrate binding pocket, permitting the binding and CoA-thioesterification activity with a broad range of carboxylic substrates, including short-, medium-chain and aromatic acids, indicating a generalist function consistent with a xenobiotic-ligase. The thioesterification activity with l-luciferin, but not with the d-enantiomer, confirms that the oxygenase activity emerged from a stereoselective impediment of the thioesterification reaction with the latter, favoring the alternative chemiluminescence oxidative reaction. The structure and site-directed mutagenesis support the involvement of the main-chain amide carbonyl of the invariant glycine G323 as the catalytic base for luciferin C4 proton abstraction during the oxygenase activity in this enzyme and in beetle luciferases (G343).


Assuntos
Besouros/química , Proteínas de Insetos/química , Luciferases/química , Oxigenases/química , Sequência de Aminoácidos , Animais , Coenzima A Ligases/química , Coenzima A Ligases/metabolismo , Besouros/enzimologia , Besouros/metabolismo , Cristalografia por Raios X , Esterificação , Proteínas de Insetos/metabolismo , Luciferases/metabolismo , Modelos Moleculares , Oxigenases/metabolismo , Conformação Proteica , Domínios Proteicos
4.
Biochem Biophys Res Commun ; 421(1): 124-8, 2012 Apr 27.
Artigo em Inglês | MEDLINE | ID: mdl-22490662

RESUMO

L-Amino acid oxidases (LAAOs) are flavoenzymes that catalytically deaminate L-amino acids to corresponding α-keto acids with the concomitant production of ammonia (NH(3)) and hydrogen peroxide (H(2)O(2)). Particularly, snake venom LAAOs have been attracted much attention due to their diverse clinical and biological effects, interfering on human coagulation factors and being cytotoxic against some pathogenic bacteria and Leishmania ssp. In this work, a new LAAO from Bothrops jararacussu venom (BjsuLAAO) was purified, functionally characterized and its structure determined by X-ray crystallography at 3.1 Å resolution. BjsuLAAO showed high catalytic specificity for aromatic and aliphatic large side-chain amino acids. Comparative structural analysis with prokaryotic LAAOs, which exhibit low specificity, indicates the importance of the active-site volume in modulating enzyme selectivity. Surprisingly, the flavin adenine dinucleotide (FAD) cofactor was found in a different orientation canonically described for both prokaryotic and eukaryotic LAAOs. In this new conformational state, the adenosyl group is flipped towards the 62-71 loop, being stabilized by several hydrogen-bond interactions, which is equally stable to the classical binding mode.


Assuntos
Bothrops , Venenos de Crotalídeos/enzimologia , L-Aminoácido Oxidase/química , Sequência de Aminoácidos , Animais , Cristalografia por Raios X , Estabilidade Enzimática , Interações Hidrofóbicas e Hidrofílicas , Dados de Sequência Molecular , Estrutura Secundária de Proteína
5.
J Mol Biol ; 366(2): 602-10, 2007 Feb 16.
Artigo em Inglês | MEDLINE | ID: mdl-17173931

RESUMO

NAPc2, an anticoagulant protein from the hematophagous nematode Ancylostoma caninum evaluated in phase-II/IIa clinical trials, inhibits the extrinsic blood coagulation pathway by a two step mechanism, initially interacting with the hitherto uncharacterized factor Xa exosite involved in macromolecular recognition and subsequently inhibiting factor VIIa (K(i)=8.4 pM) of the factor VIIa/tissue factor complex. NAPc2 is highly flexible, becoming partially ordered and undergoing significant structural changes in the C terminus upon binding to the factor Xa exosite. In the crystal structure of the ternary factor Xa/NAPc2/selectide complex, the binding interface consists of an intermolecular antiparallel beta-sheet formed by the segment of the polypeptide chain consisting of residues 74-80 of NAPc2 with the residues 86-93 of factor Xa that is additional maintained by contacts between the short helical segment (residues 67-73) and a turn (residues 26-29) of NAPc2 with the short C-terminal helix of factor Xa (residues 233-243). This exosite is physiologically highly relevant for the recognition and inhibition of factor X/Xa by macromolecular substrates and provides a structural motif for the development of a new class of inhibitors for the treatment of deep vein thrombosis and angioplasty.


Assuntos
Ancylostoma/química , Fator Xa/química , Proteínas de Helminto/química , Animais , Anticoagulantes/farmacologia , Sítios de Ligação , Bovinos , Fator VIIa/química , Fator VIIa/metabolismo , Fator Xa/metabolismo , Humanos , Modelos Moleculares , Dados de Sequência Molecular , Ligação Proteica , Estrutura Terciária de Proteína , Relação Estrutura-Atividade , Tromboplastina/química , Tromboplastina/metabolismo
6.
Protein Pept Lett ; 15(7): 724-30, 2008.
Artigo em Inglês | MEDLINE | ID: mdl-18782069

RESUMO

Miliin, a new thiol-dependent serine protease purified from the latex of Euphorbia milii possesses a molecular weight of 79 kDa, an isoelectric point of 4.3 and is optimally active at 60 degrees C in the pH range of and 7.5-11.0. Activity tests indicate that milliin is a thiol-dependent serine protease.


Assuntos
Euphorbia/enzimologia , Serina Endopeptidases/isolamento & purificação , Eletroforese em Gel de Poliacrilamida , Concentração de Íons de Hidrogênio , Focalização Isoelétrica , Ponto Isoelétrico , Cinética , Látex/química , Peso Molecular , Serina Endopeptidases/química , Serina Endopeptidases/metabolismo , Temperatura
7.
Artigo em Inglês | MEDLINE | ID: mdl-17401196

RESUMO

Crotoxin, a potent neurotoxin from the venom of the South American rattlesnake Crotalus durissus terrificus, exists as a heterodimer formed between a phospholipase A(2) and a catalytically inactive acidic phospholipase A(2) analogue (crotapotin). Large single crystals of the crotoxin complex and of the isolated subunits have been obtained. The crotoxin complex crystal belongs to the orthorhombic space group P2(1)2(1)2, with unit-cell parameters a = 38.2, b = 68.7, c = 84.2 A, and diffracted to 1.75 A resolution. The crystal of the phospholipase A(2) domain belongs to the hexagonal space group P6(1)22 (or its enantiomorph P6(5)22), with unit-cell parameters a = b = 38.7, c = 286.7 A, and diffracted to 2.6 A resolution. The crotapotin crystal diffracted to 2.3 A resolution; however, the highly diffuse diffraction pattern did not permit unambiguous assignment of the unit-cell parameters.


Assuntos
Crotoxina/química , Fosfolipases A/química , Cristalização , Cristalografia por Raios X , Dimerização , Fosfolipases A2 , Conformação Proteica
8.
Sci Rep ; 7: 43692, 2017 03 07.
Artigo em Inglês | MEDLINE | ID: mdl-28266547

RESUMO

Myosin Va (MyoVa) is an actin-based molecular motor abundantly found at the centrosome. However, the role of MyoVa at this organelle has been elusive due to the lack of evidence on interacting partners or functional data. Herein, we combined yeast two-hybrid screen, biochemical studies and cellular assays to demonstrate that MyoVa interacts with RPGRIP1L, a cilia-centrosomal protein that controls ciliary signaling and positioning. MyoVa binds to the C2 domains of RPGRIP1L via residues located near or in the Rab11a-binding site, a conserved site in the globular tail domain (GTD) from class V myosins. According to proximity ligation assays, MyoVa and RPGRIP1L can interact near the cilium base in ciliated RPE cells. Furthermore, we showed that RPE cells expressing dominant-negative constructs of MyoVa are mostly unciliated, providing the first experimental evidence about a possible link between this molecular motor and cilia-related processes.


Assuntos
Proteínas Adaptadoras de Transdução de Sinal/metabolismo , Cadeias Pesadas de Miosina/metabolismo , Miosina Tipo V/metabolismo , Proteínas Adaptadoras de Transdução de Sinal/química , Proteínas Adaptadoras de Transdução de Sinal/genética , Sequência de Aminoácidos , Sítios de Ligação , Centrossomo/metabolismo , Cílios/genética , Cílios/metabolismo , Sequência Conservada , Humanos , Modelos Moleculares , Cadeias Pesadas de Miosina/química , Cadeias Pesadas de Miosina/genética , Miosina Tipo V/química , Miosina Tipo V/genética , Ligação Proteica , Conformação Proteica , Domínios e Motivos de Interação entre Proteínas , Proteínas Recombinantes
9.
Biochimie ; 88(5): 543-9, 2006 May.
Artigo em Inglês | MEDLINE | ID: mdl-16376474

RESUMO

The electrophile Ca(2+) is an essential multifunctional co-factor in the phospholipase A(2) mediated hydrolysis of phospholipids. Crystal structures of an acidic phospholipase A(2) from the venom of Bothrops jararacussu have been determined both in the Ca(2+) free and bound states at 0.97 and 1.60 A resolutions, respectively. In the Ca(2+) bound state, the Ca(2+) ion is penta-coordinated by a distorted pyramidal cage of oxygen and nitrogen atoms that is significantly different to that observed in structures of other Group I/II phospholipases A(2). In the absence of Ca(2+), a water molecule occupies the position of the Ca(2+) ion and the side chain of Asp49 and the calcium-binding loop adopts a different conformation.


Assuntos
Cálcio/metabolismo , Fosfolipases A/química , Fosfolipases A/metabolismo , Animais , Sítios de Ligação , Bothrops/metabolismo , Venenos de Crotalídeos/enzimologia , Cristalização , Cristalografia por Raios X/métodos , Fosfolipases A2 do Grupo IV , Ligação de Hidrogênio , Modelos Moleculares , Fosfolipases A2 , Ligação Proteica , Estrutura Secundária de Proteína , Estrutura Terciária de Proteína
10.
Artigo em Inglês | MEDLINE | ID: mdl-16510999

RESUMO

Xylanases have been the focus of research owing to their industrial potential in animal feed production, food processing and pulp and paper processes. In order to obtain insight into the structural stability of family 11 xylanases, the mesophilic family 11 xylanase (beta-1,4-xylan xylanohydrolase; EC 3.2.1.8) from Bacillus subtilis 1A1 has been crystallized and diffraction data have been collected to 1.7 A. The crystals belong to the orthorhombic space group P2(1)2(1)2, with unit-cell parameters a = 50.93, b = 70.50, c = 40.05 A. The structure has been determined by molecular replacement, resulting in a crystallographic residual of 36.4% after rigid-body refinement.


Assuntos
Bacillus subtilis/enzimologia , Endo-1,4-beta-Xilanases/química , Proteínas de Bactérias/química , Proteínas de Bactérias/isolamento & purificação , Cristalografia por Raios X , Endo-1,4-beta-Xilanases/isolamento & purificação , Conformação Proteica , Difração de Raios X
11.
Curr Protein Pept Sci ; 16(8): 768-74, 2015.
Artigo em Inglês | MEDLINE | ID: mdl-25961401

RESUMO

Phospholipases D (PLDs), the major dermonecrotic factors from brown spider venoms, trigger a range of biological reactions both in vitro and in vivo. Despite their clinical relevance in loxoscelism, structural data is restricted to the apo-form of these enzymes, which has been instrumental in understanding the functional differences between the class I and II spider PLDs. The crystal structures of the native class II PLD from Loxosceles intermedia complexed with myo-inositol 1-phosphate and the inactive mutant H12A complexed with fatty acids indicate the existence of a strong ligand-dependent conformation change of the highly conserved aromatic residues, Tyr 223 and Trp225 indicating their roles in substrate binding. These results provided insights into the structural determinants for substrate recognition and binding by class II PLDs.


Assuntos
Fosfolipase D/química , Fosfolipase D/metabolismo , Diester Fosfórico Hidrolases/química , Diester Fosfórico Hidrolases/metabolismo , Venenos de Aranha/química , Venenos de Aranha/metabolismo , Aranhas/química , Sequência de Aminoácidos , Animais , Caprilatos/metabolismo , Cristalografia por Raios X , Fosfatos de Inositol , Modelos Moleculares , Dados de Sequência Molecular , Proteínas Mutantes/química , Proteínas Mutantes/metabolismo , Alinhamento de Sequência , Especificidade por Substrato
12.
Biochimie ; 85(10): 983-91, 2003 Oct.
Artigo em Inglês | MEDLINE | ID: mdl-14644553

RESUMO

Acidic phospholipase A(2) (PLA(2)) isoforms in snake venoms, particularly those from Bothrops jararacussu, have not been characterized. This article reports the isolation and partial biochemical, functional and structural characterization of four acidic PLA(2)s (designated SIIISPIIA, SIIISPIIB, SIIISPIIIA and SIIISPIIIB) from this venom. The single chain purified proteins contained 122 amino acid residues and seven disulfide bonds with approximate molecular masses of 15 kDa and isoelectric points of 5.3. The respective N-terminal sequences were: SIIISPIIA-SLWQFGKMIDYVMGEEGAKS; SIIISPIIB-SLWQFGKMIFYTGKNEPVLS; SIIISPIIIA-SLWQFGKMILYVMGGEGVKQ and SIIISPIIIB-SLWQFGKMIFYEMTGEGVL. Crystals of the acidic protein SIIISPIIB diffracted beyond 1.8 A resolution. These crystals are monoclinic with unit cell dimensions of a = 40.1 A, b = 54.2 A and c = 90.7 A. The crystal structure has been refined to a crystallographic residual of 16.1% (R(free) = 22.9%). Specific catalytic activity (U/mg) of the isolated acidic PLA(2)s were SIIISPIIA = 290.3 U/mg; SIIISPIIB = 279.0 U/mg; SIIISPIIIA = 270.7 U/mg and SIIISPIIIB = 96.5 U/mg. Although their myotoxic activity was low, SIIISPIIA, SIIISPIIB and SIIISPIIIA showed significant anticoagulant activity. However, there was no indirect hemolytic activity. SIIISPIIIB revealed no anticoagulant, but presented indirect hemolytic activity. With the exception of SIIISPIIB, which inhibited platelet aggregation, all the others were capable of inducing time-independent edema. Chemical modification with 4-bromophenacyl bromide did not inhibit the induction of edema, but did suppress other activities.


Assuntos
Bothrops , Venenos de Crotalídeos/enzimologia , Fosfolipases A/química , Sequência de Aminoácidos , Animais , Creatina Quinase/metabolismo , Venenos de Crotalídeos/química , Venenos de Crotalídeos/toxicidade , Cristalografia por Raios X , Edema/induzido quimicamente , Técnicas In Vitro , Isoenzimas/química , Isoenzimas/isolamento & purificação , Isoenzimas/farmacologia , Camundongos , Modelos Moleculares , Dados de Sequência Molecular , Músculos/efeitos dos fármacos , Fosfolipases A/isolamento & purificação , Fosfolipases A/farmacologia , Fosfolipases A/toxicidade , Fosfolipases A2 , Inibidores da Agregação Plaquetária/química , Inibidores da Agregação Plaquetária/isolamento & purificação , Inibidores da Agregação Plaquetária/farmacologia , Conformação Proteica
13.
Toxicon ; 42(8): 903-13, 2003 Dec 15.
Artigo em Inglês | MEDLINE | ID: mdl-15019490

RESUMO

Venom phospholipase A2s (PLA2s) display a wide spectrum of pharmacological activities and, based on the wealth of biochemical and structural data currently available for PLA2s, mechanistic models can now be inferred to account for some of these activities. A structural model is presented for the role played by the distribution of surface electrostatic potential in the ability of myotoxic D49/K49 PLA2s to disrupt multilamellar vesicles containing negatively charged natural and non-hydrolyzable phospholipids. Structural evidence is provided for the ability of K49 PLA2s to bind phospholipid analogues and for the existence of catalytic activity in K49 PLA2s. The importance of the existence of catalytic activity of D49 and K49 PLA2s in myotoxicity is presented.


Assuntos
Lipossomos/metabolismo , Modelos Químicos , Fosfolipases A/metabolismo , Venenos de Serpentes/metabolismo , Serpentes , Animais , Catálise , Fosfolipases A/toxicidade , Estrutura Quaternária de Proteína , Venenos de Serpentes/toxicidade , Eletricidade Estática
14.
Curr Med Chem ; 21(20): 2322-30, 2014.
Artigo em Inglês | MEDLINE | ID: mdl-24438525

RESUMO

Anticancer drug research based on natural compounds enabled the discovery of many drugs currently used in cancer therapy. Here, we report the in vitro, in vivo and in silico anticancer and estrogen-like activity of Psidium guajava L. (guava) extracts and enriched mixture containing the meroterpenes guajadial, psidial A and psiguadial A and B. All samples were evaluated in vitro for anticancer activity against nine human cancer lines: K562 (leukemia), MCF7 (breast), NCI/ADR-RES (resistant ovarian cancer), NCI-H460 (lung), UACC-62 (melanoma), PC-3 (prostate), HT-29 (colon), OVCAR-3 (ovarian) and 786-0 (kidney). Psidium guajava's active compounds displayed similar physicochemical properties to estradiol and tamoxifen, as in silico molecular docking studies demonstrated that they fit into the estrogen receptors (ERs). The meroterpene-enriched fraction was also evaluated in vivo in a Solid Ehrlich murine breast adenocarcinoma model, and showed to be highly effective in inhibiting tumor growth, also demonstrating uterus increase in comparison to negative controls. The ability of guajadial, psidial A and psiguadials A and B to reduce tumor growth and stimulate uterus proliferation, as well as their in silico docking similarity to tamoxifen, suggest that these compounds may act as Selective Estrogen Receptors Modulators (SERMs), therefore holding significant potential for anticancer therapy.


Assuntos
Antineoplásicos Fitogênicos/farmacologia , Proliferação de Células/efeitos dos fármacos , Neoplasias/patologia , Extratos Vegetais/farmacologia , Psidium/química , Moduladores Seletivos de Receptor Estrogênico/farmacologia , Animais , Linhagem Celular Tumoral , Biologia Computacional/métodos , Estrogênios , Feminino , Humanos , Camundongos Endogâmicos BALB C , Neoplasias/metabolismo , Extratos Vegetais/química , Folhas de Planta/química , Ensaios Antitumorais Modelo de Xenoenxerto
15.
Protein Sci ; 22(1): 128-32, 2013 Jan.
Artigo em Inglês | MEDLINE | ID: mdl-23139169

RESUMO

Snake venom serine proteinases (SVSPs) are hemostatically active toxins that perturb the maintenance and regulation of both the blood coagulation cascade and fibrinolytic feedback system at specific points, and hence, are widely used as tools in pharmacological and clinical diagnosis. The crystal structure of a thrombin-like enzyme (TLE) from Bothrops jararacussu venom (Jararacussin-I) was determined at 2.48 Å resolution. This is the first crystal structure of a TLE and allows structural comparisons with both the Agkistrodon contortrix contortrix Protein C Activator and the Trimeresurus stejnegeri plasminogen activator. Despite the highly conserved overall fold, significant differences in the amino acid compositions and three-dimensional conformations of the loops surrounding the active site significantly alter the molecular topography and charge distribution profile of the catalytic interface. In contrast to other SVSPs, the catalytic interface of Jararacussin-I is highly negatively charged, which contributes to its unique macromolecular selectivity.


Assuntos
Serina Endopeptidases/química , Venenos de Serpentes/enzimologia , Trombina/química , Trombina/economia , Venenos de Víboras/química , Animais , Biocatálise , Bothrops , Cromatografia de Afinidade , Cromatografia em Gel , Cristalografia por Raios X , Substâncias Macromoleculares/química , Substâncias Macromoleculares/metabolismo , Modelos Moleculares , Conformação Proteica , Serina Endopeptidases/isolamento & purificação , Serina Endopeptidases/metabolismo , Venenos de Víboras/isolamento & purificação , Venenos de Víboras/metabolismo
16.
Int J Biol Macromol ; 51(3): 209-14, 2012 Oct.
Artigo em Inglês | MEDLINE | ID: mdl-22584077

RESUMO

Catalytically inactive phospholipase A(2) (PLA(2)) homologues play key roles in the pathogenesis induced by snake envenomation, causing extensive tissue damage via a mechanism still unknown. Although, the amino acid residues directly involved in catalysis are conserved, the substitution of Asp49 by Arg/Lys/Gln or Ser prevents the binding of the essential calcium ion and hence these proteins are incapable of hydrolyzing phospholipids. In this work, the crystal structure of a Lys49-PLA(2) homologue from Bothrops brazili (MTX-II) was solved in two conformational states: (a) native, with Lys49 singly coordinated by the backbone oxygen atom of Val31 and (b) complexed with tetraethylene glycol (TTEG). Interestingly, the TTEG molecule was observed in two different coordination cages depending on the orientation of the nominal calcium-binding loop and of the residue Lys49. These structural observations indicate a direct role for the residue Lys49 in the functioning of a catalytically inactive PLA(2) homologue suggesting a contribution of the active site-like region in the expression of pharmacological effects such as myotoxicity and edema formation. Despite the several crystal structures of Lys49-PLA(2) homologues already determined, their biological assembly remains controversial with two possible conformations. The extended dimer with the hydrophobic channel exposed to the solvent and the compact dimer in which the active site-like region is occluded by the dimeric interface. In the MTX-II crystal packing analysis was found only the extended dimer as a possible stable quaternary arrangement.


Assuntos
Proteínas Mutantes/química , Fosfolipases A2/química , Animais , Domínio Catalítico , Etilenoglicóis/química , Ligantes , Modelos Moleculares , Proteínas Mutantes/isolamento & purificação , Fosfolipases A2/isolamento & purificação , Conformação Proteica , Multimerização Proteica , Estrutura Secundária de Proteína
17.
Toxicon ; 60(1): 70-82, 2012 Jul.
Artigo em Inglês | MEDLINE | ID: mdl-22483847

RESUMO

The structures and functional activities of metalloproteinases from snake venoms have been widely studied because of the importance of these molecules in envenomation. Batroxase, which is a metalloproteinase isolated from Bothrops atrox (Pará) snake venom, was obtained by gel filtration and anion exchange chromatography. The enzyme is a single protein chain composed of 202 amino acid residues with a molecular mass of 22.9 kDa, as determined by mass spectrometry analysis, showing an isoelectric point of 7.5. The primary sequence analysis indicates that the proteinase contains a zinc ligand motif (HELGHNLGISH) and a sequence C164 I165M166 motif that is associated with a "Met-turn" structure. The protein lacks N-glycosylation sites and contains seven half cystine residues, six of which are conserved as pairs to form disulfide bridges. The three-dimensional structure of Batroxase was modeled based on the crystal structure of BmooMPα-I from Bothrops moojeni. The model revealed that the zinc binding site has a high structural similarity to the binding site of other metalloproteinases. Batroxase presented weak hemorrhagic activity, with a MHD of 10 µg, and was able to hydrolyze extracellular matrix components, such as type IV collagen and fibronectin. The toxin cleaves both α and ß-chains of the fibrinogen molecule, and it can be inhibited by EDTA, EGTA and ß-mercaptoethanol. Batroxase was able to dissolve fibrin clots independently of plasminogen activation. These results demonstrate that Batroxase is a zinc-dependent hemorrhagic metalloproteinase with fibrin(ogen)olytic and thrombolytic activity.


Assuntos
Venenos de Crotalídeos/enzimologia , Fibrinólise , Metaloproteases/metabolismo , Sequência de Aminoácidos , Animais , Bothrops , Ponto Isoelétrico , Espectrometria de Massas , Metaloproteases/química , Modelos Moleculares , Dados de Sequência Molecular , Homologia de Sequência de Aminoácidos
18.
Bioresour Technol ; 119: 293-9, 2012 Sep.
Artigo em Inglês | MEDLINE | ID: mdl-22750495

RESUMO

Plant cell wall degrading enzymes are key technological components in biomass bioconversion platforms for lignocellulosic materials transformation. Cost effective production of enzymes and identification of efficient degradation routes are two economic bottlenecks that currently limit the use of renewable feedstocks through an environmental friendly pathway. The present study describes the hypersecretion of an endo-xylanase (GH11) and an arabinofuranosidase (GH54) by a fungal expression system with potential biotechnological application, along with comprehensive characterization of both enzymes, including spectrometric analysis of thermal denaturation, biochemical characterization and mode of action description. The synergistic effect of these enzymes on natural substrates such as sugarcane bagasse, demonstrated the biotechnological potential of using GH11 and GH54 for production of probiotic xylooligosaccharides from plant biomass. Our findings shed light on enzymatic mechanisms for xylooligosaccharide production, as well as provide basis for further studies for the development of novel enzymatic routes for use in biomass-to-bioethanol applications.


Assuntos
Aspergillus/enzimologia , Endo-1,4-beta-Xilanases/metabolismo , Proteínas Fúngicas/metabolismo , Glucuronatos/biossíntese , Glicosídeo Hidrolases/metabolismo , Oligossacarídeos/biossíntese , Penicillium/enzimologia , Aspergillus/genética , Endo-1,4-beta-Xilanases/genética , Proteínas Fúngicas/genética , Glucuronatos/isolamento & purificação , Glicosídeo Hidrolases/genética , Oligossacarídeos/isolamento & purificação , Penicillium/genética , Engenharia de Proteínas/métodos
19.
Toxicon ; 55(2-3): 361-8, 2010.
Artigo em Inglês | MEDLINE | ID: mdl-19706302

RESUMO

Hemostatically active snake venom metalloproteinases (SVMPs) perturb the blood coagulation cascade at specific points and due to their potential application as thrombolytic agents, the fibrin(ogen)olytic non-hemorrhagic SVMPs have been employed as biochemical tools in coagulation research and diagnosis. Structural studies complemented by the design of metalloproteinase inhibitors have been instrumental in understanding their stereo specificity and action mechanism. We present here, details of the crystal structure of BmooMPalpha-I, a 22.6 kDa non-hemorrhagic P-I class SVMP isolated from Bothrops moojeni venom, determined at 1.76 A resolution. In this structure, the catalytic zinc ion displays an unusual octahedral coordination formed by the three canonical histidines (His(142), His(146) and His(152)) and additionally, by three solvent molecules. Comparative sequence and structural studies indicate that the motif comprising amino acid segments 153-164 and 167-176 adjacent to the methionine-turn is a salient feature that differentiates both non and hemorrhagic P-I class SVMPs and could directly be involved in the development of the hemorrhagic activity.


Assuntos
Bothrops/fisiologia , Metaloproteases/química , Venenos de Víboras/enzimologia , Sequência de Aminoácidos , Animais , Cristalização , Eletroforese em Gel de Poliacrilamida , Hemorragia/induzido quimicamente , Metaloproteases/antagonistas & inibidores , Metaloproteases/farmacologia , Modelos Moleculares , Dados de Sequência Molecular , Inibidores de Proteases/química , Inibidores de Proteases/farmacologia , Ligação Proteica , Conformação Proteica , Espectrometria de Massas por Ionização por Electrospray , Relação Estrutura-Atividade , Especificidade por Substrato , Venenos de Víboras/farmacologia , Difração de Raios X , Zinco/química
20.
SELEÇÃO DE REFERÊNCIAS
Detalhe da pesquisa