Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 15 de 15
Filtrar
1.
Calcif Tissue Int ; 86(3): 249-60, 2010 Mar.
Artigo em Inglês | MEDLINE | ID: mdl-20127324

RESUMO

Amylin(1-8), a cyclic peptide consisting of the eight N-terminal amino acids of the 37-amino acid peptide amylin, has been shown to induce proliferation of primary osteoblasts and to induce bone formation in healthy male mice, whereas no data on efficacy in bone disease-related models have been reported. Therefore, we evaluated any effects of amylin(1-8) in ovariectomized rats with established osteopenia, a model for postmenopausal osteoporosis. At doses up to 100 nmol/kg/day, a dose highly effective in healthy mice, amylin(1-8) was unable to increase bone mineral density in ovariectomized rats during an 8-week treatment period. Histomorphometric analysis of the tibia indicated that amylin(1-8) did not change bone histomorphometric parameters. In an attempt to verify any potential biological effects of amylin(1-8), we investigated the efficacy of this peptide in various in vitro assays. Experiments designed to confirm previously published results on the proliferative effects of amylin(1-8) on primary osteoblasts failed to show any response. Amylin(1-8) was able to partially displace (125)I-rat amylin(1-37) from amylin receptors composed of the calcitonin receptor and RAMP1, indicating specific interaction of the peptide with the amylin binding site. However, in vitro efficacy assays with amylin(1-8) in calcitonin receptor-RAMP-positive HEK293T and MCF7 cells failed to reveal any agonist activity of amylin(1-8), whereas amylin(1-37) showed the expected agonist activity. In conclusion, our results indicate that amylin(1-8) does not show agonist activity on amylin receptors, does not affect osteoblast proliferation, and is devoid of anabolic activity in bone.


Assuntos
Amiloide/farmacologia , Anabolizantes/farmacologia , Regeneração Óssea/efeitos dos fármacos , Osteogênese/efeitos dos fármacos , Fragmentos de Peptídeos/farmacologia , Amiloide/uso terapêutico , Anabolizantes/uso terapêutico , Animais , Animais Recém-Nascidos , Sítios de Ligação/efeitos dos fármacos , Sítios de Ligação/fisiologia , Doenças Ósseas Metabólicas/tratamento farmacológico , Doenças Ósseas Metabólicas/metabolismo , Doenças Ósseas Metabólicas/fisiopatologia , Regeneração Óssea/fisiologia , Linhagem Celular , Linhagem Celular Tumoral , Modelos Animais de Doenças , Relação Dose-Resposta a Droga , Feminino , Humanos , Peptídeos e Proteínas de Sinalização Intracelular/efeitos dos fármacos , Peptídeos e Proteínas de Sinalização Intracelular/metabolismo , Polipeptídeo Amiloide das Ilhotas Pancreáticas , Proteínas de Membrana/efeitos dos fármacos , Proteínas de Membrana/metabolismo , Camundongos , Osteoblastos/efeitos dos fármacos , Osteoblastos/metabolismo , Osteogênese/fisiologia , Ovariectomia , Fragmentos de Peptídeos/uso terapêutico , Peptídeos/farmacologia , Peptídeos/uso terapêutico , Ratos , Ratos Sprague-Dawley , Proteína 1 Modificadora da Atividade de Receptores , Proteínas Modificadoras da Atividade de Receptores , Receptores da Calcitonina/efeitos dos fármacos , Receptores da Calcitonina/metabolismo
2.
J Pharmacol Exp Ther ; 328(2): 533-9, 2009 Feb.
Artigo em Inglês | MEDLINE | ID: mdl-19028991

RESUMO

The aim of the present study was to examine the mechanisms responsible for the antinatriuretic effect of the selective, peripherally acting, nociceptin/orphanin FQ peptide (NOP) receptor partial agonist Ac-RYYRWKKKKKKK-NH(2) (ZP120). Using immunohistochemistry, we showed that in the cortex NOP receptors are expressed in the distal convoluted tubules, the connecting tubules, and the collecting ducts. Using clearance techniques, we evaluated renal excretory function during acute administration of ZP120 (1 nmol/kg/min) in chronically catheterized, conscious rats (n = 8/group). To examine the hypothesis that ZP120 induces direct renal effects by modifying the activity of sodium transporters in the distal convoluted tubules or in the collecting ducts, ZP120-induced antinatriuresis was examined during coadministration of an inhibitor of the NaCl cotransporter, bendroflumethiazide, or a blocker of the epithelial sodium channel, amiloride, respectively. ZP120 produced a marked antinatriuresis [fractional excretion of sodium (FE(Na)): ZP120, 0.3 +/- 0.1% versus control, 0.9 +/- 0.1%; p < 0.05] in sodium-replete rats. The natriuretic response to amiloride was significantly increased in ZP120-treated rats compared with controls (DeltaFE(Na): ZP120, 1.1 +/- 0.2% versus control, 0.5 +/- 0.2%; p < 0.01), whereas the effect of BFTZ was equal in ZP120-treated rats and controls. These results suggest that ZP120 exerts a direct renal NOP receptor-mediated stimulatory effect on the epithelial sodium channel in the collecting ducts.


Assuntos
Absorção/efeitos dos fármacos , Amilorida/farmacologia , Natriurese/efeitos dos fármacos , Oligopeptídeos/farmacologia , Receptores Opioides/agonistas , Sódio/metabolismo , Absorção/fisiologia , Animais , Interações Medicamentosas , Imuno-Histoquímica , Natriurese/fisiologia , Peptídeos Opioides/farmacologia , Ratos , Ratos Wistar , Receptor de Nociceptina , Nociceptina
3.
Endocrinology ; 146(11): 4745-54, 2005 Nov.
Artigo em Inglês | MEDLINE | ID: mdl-16109789

RESUMO

Gap junctions play an important role in bone development and function, but the lack of pharmacological tools has hampered the gap junction research. The antiarrhythmic peptides stimulate gap junction communication between cardiomyocytes, but effects in noncardiac tissue are unknown. The purpose of this study was to examine whether antiarrhythmic peptides, which are small peptides increasing gap junctional conductivity, show specific binding to osteoblasts and investigate the effect of the stable analog rotigaptide (ZP123) on gap junctional intercellular communication in vitro and on bone mass and strength in vivo. Cell coupling and calcium signaling were assessed in vitro on human, primary, osteoblastic cells. In vivo effects of rotigaptide on bone strength and density were determined 4 wk after ovariectomy in rats treated with either vehicle, sc injection twice daily (300 nmol per kilogram body weight) or by continuous ip infusion (158 nmol per kilogram body weight per day). During metabolic stress, a high affinity-binding site (KD=0.1 nM) with low density (15 fmol/mg protein) for [125I]di-I-AAP10 was demonstrated. During physiological conditions, specific binding sites for [125I]AAP10 could not be shown. Studies of the effects of rotigaptide on propagation of intercellular calcium waves and cell-to-cell coupling demonstrated that 10 nM rotigaptide produced a small increase in intercellular communication during physiological conditions (+4.5+/-1.6% vs. vehicle; P<0.05). During conditions with metabolic stress, 10 nM rotigaptide produced an increase in coupling measured by both methods. Four weeks after ovariectomy, bone strength of the femoral head was reduced by 20% in vehicle-treated ovariectomized rats, which was completely prevented in both rotigaptide-treated groups. Rotigaptide also prevented decreases in bone mineral. We conclude that the stable analog rotigaptide increases gap junctional communication in osteoblasts in vitro and preferably during conditions with metabolic stress. Rotigaptide further prevents ovariectomy-induced bone loss in vivo. Thus, gap junction modulation may be a promising new target for osteoporosis therapy.


Assuntos
Comunicação Celular/efeitos dos fármacos , Fêmur/fisiologia , Junções Comunicantes/fisiologia , Oligopeptídeos/farmacologia , Osteoblastos/fisiologia , Ovariectomia , Adulto , Animais , Densidade Óssea/efeitos dos fármacos , Hipóxia Celular/fisiologia , Células Cultivadas , Força Compressiva/efeitos dos fármacos , DDT/farmacologia , Feminino , Fêmur/citologia , Humanos , Infusões Parenterais , Injeções Subcutâneas , Inseticidas/farmacologia , Radioisótopos do Iodo , Oligopeptídeos/administração & dosagem , Oligopeptídeos/metabolismo , Ratos , Ratos Wistar , Transdução de Sinais/efeitos dos fármacos , Estresse Fisiológico/metabolismo
4.
Cell Commun Adhes ; 12(5-6): 271-8, 2005.
Artigo em Inglês | MEDLINE | ID: mdl-16531322

RESUMO

Rotigaptide (ZP123) increases gap junction intercellular communication (GJIC) and prevents stress-induced cardiac conduction velocity (CV) slowing. However, the effect of rotigaptide on established cardiac conduction slowing and the duration of effect on rotigaptide during washout is unknown. Metabolic stress (induced by superfusion with nonoxygenated glucose-free Tyrodes buffer) was associated with a 30% decrease in atrial CV in vehicle-treated rat atria. Rotigaptide treatment initiated after a period of 30 minutes of metabolic stress produced a rapid and significant increase in CV compared to vehicle-treated time controls. During washout of rotigaptide for 30 min (while subjected to metabolic stress), there was a minor decrease in atrial CV; however, this was not significantly different from atrial CV in a rotigaptide-treated time control group. Rotigaptide treatment rapidly normalizes established conduction slowing in atria subjected to metabolic stress. However, the cessation of effect was considerably slower than the onset of action.


Assuntos
Antiarrítmicos/farmacologia , Átrios do Coração/efeitos dos fármacos , Sistema de Condução Cardíaco/efeitos dos fármacos , Oligopeptídeos/farmacologia , Animais , Antiarrítmicos/uso terapêutico , Arritmias Cardíacas/tratamento farmacológico , Arritmias Cardíacas/fisiopatologia , Átrios do Coração/fisiopatologia , Técnicas In Vitro , Masculino , Contração Miocárdica , Oligopeptídeos/uso terapêutico , Estresse Oxidativo , Ratos , Ratos Sprague-Dawley , Fatores de Tempo
5.
Br J Pharmacol ; 137(3): 369-74, 2002 Oct.
Artigo em Inglês | MEDLINE | ID: mdl-12237257

RESUMO

1 This study reports on the pharmacological characterization of ZP120, a novel ligand of the nociceptin/orphanin FQ (N/OFQ) peptide receptor, NOP. ZP120 is a structure inducing probes modified NOP ligand: Zealand Pharma proprietary SIP technology was used to increase the enzymatic stability and half-life of peptide. 2 In vitro, ZP120 mimicked the inhibitory effects of N/OFQ in the electrically stimulated mouse vas deferens, showing however higher potency (pEC(50) 8.88 vs 7.74), lower maximal effects (E(max) 69+/-5% vs 91+/-2%), and slower onset of action. Like N/OFQ, the effects of ZP120 were not modified by 1 micro M naloxone, but they were antagonized by the NOP receptor selective antagonist J-113397 (pA(2) 7.80 vs ZP120, 7.81 vs N/OFQ). 3 In vivo, ZP120 mimicked the effects of N/OFQ, producing pronociceptive effects in the tail withdrawal assay and decreased locomotor activity after i.c.v., but not after i.v. administration in mice. ZP120 elicited similar maximal effects as N/OFQ, but it was about 10 fold more potent and its effects lasted longer. 4 In conclusion, the novel NOP receptor ligand ZP120 is a highly potent and selective partial agonist of the NOP receptor with prolonged effects in vivo.


Assuntos
Antagonistas de Entorpecentes , Oligopeptídeos/farmacologia , Peptídeos Opioides/metabolismo , Animais , Benzimidazóis/farmacologia , Relação Dose-Resposta a Droga , Estimulação Elétrica , Técnicas In Vitro , Injeções Intravenosas , Ligantes , Masculino , Camundongos , Atividade Motora/efeitos dos fármacos , Peptídeos Opioides/farmacologia , Piperidinas/farmacologia , Receptores Opioides/metabolismo , Ducto Deferente/efeitos dos fármacos , Ducto Deferente/fisiologia , Receptor de Nociceptina , Nociceptina
6.
Front Immunol ; 5: 233, 2014.
Artigo em Inglês | MEDLINE | ID: mdl-24904582

RESUMO

SLE is a complex autoimmune inflammatory disease characterized by pathogenic autoantibody production as a consequence of uncontrolled T-B cell activity and immune-complex deposition in various organs, including kidney, leading to tissue damage and function loss. There is a high unmet need for better treatment options other than corticosteroids and immunosuppressants. Phosphoinositol-3 kinase δ (PI3Kδ) is a promising target in this respect as it is essential in mediating B- and T-cell function in mouse and human. We report the identification of selective PI3Kδ inhibitors that blocked B-, T-, and plasmacytoid dendritic cell activities in human peripheral blood and in primary cell co-cultures (BioMAP(®)) without detecting signs of undesired toxicity. In an IFNα-accelerated mouse SLE model, our PI3Kδ inhibitors blocked nephritis development, whether administered at the onset of autoantibody appearance or the onset of proteinuria. Disease amelioration correlated with normalized immune cell numbers in the spleen, reduced immune-complex deposition as well as reduced inflammation, fibrosis, and tissue damage in the kidney. Improvements were similar to those achieved with a frequently prescribed drug for lupus nephritis, the potent immunosuppressant mycophenolate mofetil. Finally, we established a pharmacodynamics/pharmacokinetic/efficacy model that revealed that a sustained PI3Kδ inhibition of 50% is sufficient to achieve full efficacy in our disease model. These data demonstrate the therapeutic potential of PI3Kδ inhibitors in SLE and lupus nephritis.

7.
J Membr Biol ; 216(1): 23-35, 2007 Mar.
Artigo em Inglês | MEDLINE | ID: mdl-17568971

RESUMO

Much of our current knowledge about the physiological and pathophysiological role of gap junctions is based on experiments where coupling has been reduced by either chemical agents or genetic modification. This has brought evidence that gap junctions are important in many physiological processes. In a number of cases, gap junctions have been implicated in the initiation and progress of disease, and experimental uncoupling has been used to investigate the exact role of coupling. The inverse approach, i.e., to increase coupling, has become possible in recent years and represents a new way of testing the role of gap junctions. The aim of this review is to summarize the current knowledge obtained with agents that selectively increase gap junctional intercellular coupling. Two approaches will be reviewed: increasing coupling by the use of antiarrhythmic peptide and its synthetic analogs and by interfering with the gating of gap junctional channels.


Assuntos
Antiarrítmicos/farmacologia , Comunicação Celular/fisiologia , Junções Comunicantes/fisiologia , Oligopeptídeos/fisiologia , Animais , Arritmias Cardíacas/fisiopatologia , Fibrilação Atrial/fisiopatologia , Osso e Ossos/efeitos dos fármacos , Comunicação Celular/efeitos dos fármacos , Conexina 43/fisiologia , Feminino , Junções Comunicantes/efeitos dos fármacos , Homeostase/fisiologia , Humanos , Ativação do Canal Iônico/efeitos dos fármacos , Isquemia Miocárdica/fisiopatologia , Oligopeptídeos/farmacologia , Osteoblastos/efeitos dos fármacos
8.
J Cardiovasc Pharmacol ; 47(2): 236-42, 2006 Feb.
Artigo em Inglês | MEDLINE | ID: mdl-16495761

RESUMO

Treatment with non-selective drugs (eg, long-chain alcohols, halothane) that reduce gap junction intercellular communication (GJIC) is associated with reduced infarct size after myocardial infarction (MI). Therefore, it has been suggested that gap junction intercellular communication stimulating compounds may increase infarct size. The antiarrhythmic peptide analogue rotigaptide (ZP123) increases cardiac gap junction intercellular communication and the purpose of the present study was to examine the effects of rotigaptide treatment on infarct size. Myocardial infarction was induced in male rats by ligation of the left anterior descending artery (LAD). Rats (n = 156) were treated with rotigaptide at three dose levels or vehicle from the onset of ischemia and for 3 weeks following LAD occlusion. Infarct size was determined using histomorphometry after 3 weeks treatment. Rotigaptide treatment producing steady state plasma levels of 0.8 +/- 0.1, 5.5 +/- 0.5, and 86 +/- 8 nmol/L had no effect on mortality, but reduced infarct size to 90 +/- 10% (P = 0.41), 67 +/- 7% (P = 0.005), and 82 +/- 7% (P = 0.13), respectively relative to vehicle-treated myocardial infarction rats (100 +/- 12%). In contrast to what was predicted, our data demonstrates that rotigaptide treatment was associated with a significant infarct size reduction. We conclude that whereas treatment with non-selective inhibitors of gap junction intercellular communication cause a reduction in infarct size, this information cannot be extrapolated to the effects of compounds that selectively increase gap junction intercellular communication.


Assuntos
Antiarrítmicos/farmacologia , Junções Comunicantes/fisiologia , Infarto do Miocárdio/tratamento farmacológico , Infarto do Miocárdio/patologia , Oligopeptídeos/farmacologia , Animais , Antiarrítmicos/administração & dosagem , Antiarrítmicos/metabolismo , Peso Corporal/efeitos dos fármacos , Doença Crônica , Ventrículos do Coração/efeitos dos fármacos , Hemodinâmica/efeitos dos fármacos , Masculino , Infarto do Miocárdio/etiologia , Infarto do Miocárdio/fisiopatologia , Oligopeptídeos/administração & dosagem , Oligopeptídeos/metabolismo , Tamanho do Órgão/efeitos dos fármacos , Ratos , Ratos Endogâmicos Lew , Fatores de Tempo
9.
Am J Physiol Renal Physiol ; 291(3): F537-45, 2006 Sep.
Artigo em Inglês | MEDLINE | ID: mdl-16418303

RESUMO

We have previously shown that systemic treatment with the somatostatin analog octreotide has marked beneficial effects on renal function in rats with liver cirrhosis induced by common bile duct ligation (CBL; Jonassen TEN, Christensen S, Sørensen AM, Marcussen N, Flyvbjerg A, Andreasen F, and Petersen JS. Hepatology 29: 1387-1395, 1999). In the present study, we tested the hypothesis that octreotide has a direct effect on renal tubular function. Rats (CBL or Sham-CBL) were intrarenally treated with low-dose octreotide in a long-acting release formulation, which had no systemic actions (100 microg/kg body wt as a single dose). Rats receiving low-dose octreotide (sc) were used as controls. The rats were chronically instrumented, and renal function was examined 4 wk after CBL or Sham-CBL. Intrarenal octreotide administration (IROA) prevented sodium retention in CBL rats without changes in renal plasma flow, glomerular filtration rate, or circulating levels of aldosterone and vasopressin. Renal clearance studies revealed that IROA normalized the increased natriuretic efficacy of furosemide found in CBL rats. Furthermore, IROA protected against the development of hypertrophy of the inner stripe of the outer medulla and thereby the increased the volume of thick ascending limb of Henle's loop (TAL) epithelium found in CBL rats. Finally, Western blot analyses of outer medullary homogenates showed increased abundance of the furosemide-sensitive Na-K-2Cl (NKCC2) cotransporter. IROA did not affect the abundance of NCKK2 within the outer medulla. Together with the histological findings, these results indicate that IROA reduces the total number of NKCC2 within the outer medulla. In conclusion, the results indicate a direct intrarenal effect of octreotide on TAL function and morphology in cirrhotic rats.


Assuntos
Cirrose Hepática Biliar/tratamento farmacológico , Cirrose Hepática Experimental/tratamento farmacológico , Alça do Néfron/efeitos dos fármacos , Octreotida/uso terapêutico , Sódio/metabolismo , Animais , Feminino , Furosemida/farmacologia , Hemodinâmica/efeitos dos fármacos , Hipertrofia , Rim/efeitos dos fármacos , Rim/patologia , Alça do Néfron/patologia , Octreotida/administração & dosagem , Ratos , Ratos Wistar , Organismos Livres de Patógenos Específicos
10.
J Pharmacol Exp Ther ; 314(2): 652-60, 2005 Aug.
Artigo em Inglês | MEDLINE | ID: mdl-15855355

RESUMO

In conscious rats, intravenous (i.v.) administration of the hexapeptide Ac-RYYRWK-NH(2), a partial agonist of the nociceptin/orphanin FQ (N/OFQ) peptide (NOP) receptor, produces a selective water diuresis without marked cardiovascular or behavioral effects. The present study examined the in vitro and in vivo pharmacodynamic profile of the novel and potentially metabolically stable NOP receptor ligand ZP120 (Ac-RYYRWKKKKKKK-NH(2)), which was created by conjugation of a structure-inducing probe (SIP) (i.e., K(6) sequence) to Ac-RYYRWK-NH(2). In cells transfected with human NOP receptors, both Ac-RYYRWK-NH(2) and ZP120 displaced [(3)H]N/OFQ (both peptides, pK(i) = 9.6), and similar to N/OFQ inhibited forskolin-induced cAMP formation (Ac-RYYRWK-NH(2), pEC(50) = 9.2; ZP120, 9.3; N/OFQ, 9.7). In the mouse vas deferens assay (MVD), Ac-RYYRWK-NH(2) and ZP120 behaved as partial agonists, inhibiting electrically induced contractions with similar pEC(50) values (9.0 and 8.6, respectively) but with submaximal efficacy compared with N/OFQ. In MVD, both peptides blocked the responses to N/OFQ, with ZP120 being approximately 50-fold more potent than Ac-RYYRWK-NH(2). In vivo, dose-response studies in rats showed that at doses (i.v. bolus or i.v. infusion) that produced a sodium-potassium-sparing aquaresis, ZP120 and Ac-RYYRWK-NH(2) elicited a mild vasodilatory response without reflex tachycardia. However, the renal responses to ZP120 were of greater magnitude and duration. Finally, each peptide blocked the bradycardia and hypotension to N/OFQ in conscious rats, but the effect of ZP120 was of much greater duration. Together, these findings demonstrate that ZP120 is a novel, functionally selective SIP-modified NOP receptor partial agonist with increased biological activity and sodium-potassium-sparing aquaretic activity, the actions of which may be useful in the management of hyponatremia/hypokalemia in water-retaining states.


Assuntos
Diuréticos/farmacologia , Oligopeptídeos/farmacologia , Potássio/metabolismo , Receptores Opioides/agonistas , Sódio/metabolismo , Animais , Linhagem Celular , Membrana Celular/efeitos dos fármacos , Membrana Celular/metabolismo , Colforsina/farmacologia , AMP Cíclico/metabolismo , Relação Dose-Resposta a Droga , Hemodinâmica/efeitos dos fármacos , Humanos , Rim/efeitos dos fármacos , Rim/metabolismo , Masculino , Camundongos , Ratos , Ratos Sprague-Dawley , Relação Estrutura-Atividade , Ducto Deferente/efeitos dos fármacos , Receptor de Nociceptina
11.
J Cardiovasc Electrophysiol ; 16(5): 537-45, 2005 May.
Artigo em Inglês | MEDLINE | ID: mdl-15877626

RESUMO

OBJECTIVE: As atrial conduction slowing is important in the pathogenesis of atrial reentry arrhythmias, a drug that increases atrial conduction or prevents atrial conduction slowing could serve to prevent atrial reentry arrhythmias. In this study, we investigated whether the novel stable antiarrhythmic peptide analog, ZP123, was able to prevent atrial conduction slowing. METHODS: We examined the effect of ZP123 on metabolic stress-induced changes in conduction velocity (CV) and on dynamic CV restitution in isolated left atria from male Sprague-Dawley rats. We performed binding of ZP123 to a broad panel of 80 different cardiac and noncardiac ion channels and receptors and examined the effect of ZP123 on HERG channel conductance. RESULTS: ZP123 dose-dependently prevented metabolic stress-induced atrial CV slowing at doses ranging from 1 nM to 10 microM. ZP123 did not affect CV during physiological conditions nor did it affect dynamic CV restitution. ZP123 had no effect on atrial contractility. ZP123 showed no or low affinity binding to all ion channels and receptors examined. ZP123 had no effects on HERG channel activity in concentrations that affected atrial conduction. The concentration of ZP123 giving maximal effect on atrial conduction (100 nM) inhibited the outward K(+)-current by 2.7 +/- 0.1%. CONCLUSION: ZP123 has no effects on atrial conduction during physiological conditions, but it selectively prevents atrial conduction slowing during metabolic stress.


Assuntos
Átrios do Coração/efeitos dos fármacos , Sistema de Condução Cardíaco/efeitos dos fármacos , Oligopeptídeos/farmacologia , Animais , Relação Dose-Resposta a Droga , Técnicas Eletrofisiológicas Cardíacas , Átrios do Coração/metabolismo , Sistema de Condução Cardíaco/metabolismo , Técnicas In Vitro , Canais Iônicos/efeitos dos fármacos , Masculino , Contração Miocárdica/efeitos dos fármacos , Ratos , Ratos Sprague-Dawley
12.
J Pharmacol Exp Ther ; 307(2): 490-6, 2003 Nov.
Artigo em Inglês | MEDLINE | ID: mdl-12975499

RESUMO

We characterized the novel, rationally designed peptide glucagon-like peptide 1 (GLP-1) receptor agonist H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A). Receptor binding studies demonstrated that the affinity of ZP10A for the human GLP-1 receptor was 4-fold greater than the affinity of GLP-1 (7-36) amide. ZP10A demonstrated dose-dependent improvement of glucose tolerance with an ED50 value of 0.02 nmol/kg i.p. in an oral glucose tolerance test (OGTT) in diabetic db/db mice. After 42 days of treatment, ZP10A dose-dependently (0, 1, 10, or 100 nmol/kg b.i.d.; n = 10/group), decreased glycosylated hemoglobin (HbA1C) from 8.4 +/- 0.4% (vehicle) to a minimum of 6.2 +/- 0.3% (100 nmol/kg b.i.d.; p < 0.05 versus vehicle) in db/db mice. Fasting blood glucose (FBG), glucose tolerance after an OGTT, and HbA1C levels were significantly improved in mice treated with ZP10A for 90 days compared with vehicle-treated controls. Interestingly, these effects were preserved 40 days after drug cessation in db/db mice treated with ZP10A only during the first 50 days of the study. Real-time polymerase chain reaction measurements demonstrated that the antidiabetic effect of early therapy with ZP10A was associated with an increased pancreatic insulin mRNA expression relative to vehicle-treated mice. In conclusion, long-term treatment of diabetic db/db mice with ZP10A resulted in a dose-dependent improvement of FBG, glucose tolerance, and blood glucose control. Our data suggest that ZP10A preserves beta-cell function. ZP10A is considered one of the most promising new drug candidates for preventive and therapeutic intervention in type 2 diabetes.


Assuntos
Proteínas de Transporte/uso terapêutico , Diabetes Mellitus/prevenção & controle , Hipoglicemiantes/uso terapêutico , Insulina/sangue , Peptídeos/uso terapêutico , Receptores de Glucagon/agonistas , Animais , Glicemia/efeitos dos fármacos , Glicemia/metabolismo , Modelos Animais de Doenças , Progressão da Doença , Relação Dose-Resposta a Droga , Glucagon/efeitos dos fármacos , Glucagon/metabolismo , Peptídeo 1 Semelhante ao Glucagon , Receptor do Peptídeo Semelhante ao Glucagon 1 , Teste de Tolerância a Glucose , Humanos , Insulina/genética , Camundongos , Camundongos Endogâmicos C57BL , Fragmentos de Peptídeos/efeitos dos fármacos , Fragmentos de Peptídeos/metabolismo , Precursores de Proteínas/efeitos dos fármacos , Precursores de Proteínas/metabolismo , RNA Mensageiro/biossíntese , RNA Mensageiro/efeitos dos fármacos
13.
J Cardiovasc Pharmacol ; 44(1): 125-35, 2004 Jul.
Artigo em Inglês | MEDLINE | ID: mdl-15175567

RESUMO

Non-pharmacological in vivo models of atrial fibrillation (AF) have been developed in large animals only. We aimed to develop and characterize a new small animal non-pharmacological in vivo model of AF. AF was induced by transesophageal atrial burst pacing during 35 seconds periods of asphyxia in anesthetized male Sprague-Dawley rats. AF was reproducibly induced in 81% of the rats. The presence of AF was associated with an increased heart rate, and a decreased blood pressure. Treatment with amiodarone, D,L-sotalol, flecainide, and propranolol all reduced duration of AF, whereas verapamil treatment was associated with a marked profibrillatory effect. Increasing gap junction intracellular communication using the antiarrhythmic peptide analogue AAP10 did not affect AF duration. Basal plasma level of epinephrine and norepinephrine were increased 5- to 20-fold relative to values reported by others, but unchanged following 35 seconds of asphyxia. The results from our study demonstrate that the rat model shares several clinical key characteristics with human AF: (1) hemodynamic response to AF; (2) increased autonomic tone; (3) antiarrhythmic effects of clinically used drugs; (4) profibrillatory effect of verapamil. Relative to existing models of AF in larger animals, this model offers rapid, predictive, and inexpensive testing of antiarrhythmic/profibrillatory effects of new drugs.


Assuntos
Antiarrítmicos/uso terapêutico , Asfixia/complicações , Fibrilação Atrial/etiologia , Técnicas Eletrofisiológicas Cardíacas/métodos , Junções Comunicantes/efeitos dos fármacos , Oligopeptídeos/uso terapêutico , Animais , Fibrilação Atrial/tratamento farmacológico , Pressão Sanguínea/efeitos dos fármacos , Eletrocardiografia , Frequência Cardíaca/efeitos dos fármacos , Masculino , Oligopeptídeos/sangue , Ratos , Ratos Sprague-Dawley
14.
J Cardiovasc Pharmacol ; 40(5): 770-9, 2002 Nov.
Artigo em Inglês | MEDLINE | ID: mdl-12409986

RESUMO

During ischemia, cardiac gap junctions close and neighboring cells uncouple. This leads to slow conduction, increased dispersion of APD90 (duration from action potential beginning to 90% of repolarization), nonuniform anisotropy, and unidirectional conduction block, all of which favor the induction of reentry arrhythmias. It has been suggested that anti-arrhythmic peptides increase gap junction conductance during states of reduced coupling. The aim of this study was to test the effect of the anti-arrhythmic peptide N-3-(4-hydroxyphenyl)propionyl Pro-Hyp-Gly-Ala-Gly-OH (HP-5) (10(-10) ) on dispersion of epicardial APD90 during both normokalemic and hypokalemic ischemia/reperfusion in isolated perfused rabbit hearts. HP-5 did not affect average APD90, heart rate, left ventricular contractility (LVP dP/dtmax), or mean coronary flow. HP-5 significantly reduced the epicardial APD dispersion during hypokalemic ischemia (HP-5 treated: 24.1 +/- 3.4 ms, untreated: 33.9 +/- 3.1 ms, p < 0.05 versus untreated) and during normokalemic reperfusion but not during normokalemic ischemia or control conditions. In addition, among untreated hearts subjected to hypokalemic ischemia/reperfusion, seven of 10 developed ventricular fibrillation, whereas only three of nine hearts perfused with HP-5 developed ventricular fibrillation. These results show that HP-5 is able to reduce APD90 dispersion during hypokalemic ischemia in rabbit hearts.


Assuntos
Antiarrítmicos/uso terapêutico , Coração/fisiologia , Hemodinâmica/efeitos dos fármacos , Isquemia/tratamento farmacológico , alfa-Defensinas/uso terapêutico , Potenciais de Ação/efeitos dos fármacos , Animais , Eletrocardiografia , Eletrofisiologia , Masculino , Contração Miocárdica/efeitos dos fármacos , Coelhos
15.
J Pharmacol Exp Ther ; 306(3): 1191-9, 2003 Sep.
Artigo em Inglês | MEDLINE | ID: mdl-12829724

RESUMO

Antiarrhythmic peptides (AAPs) are a group of compounds with antiarrhythmic properties; however, their use has been hampered by very low plasma stability. The aim of this study was to compare the in vitro and in vivo stability of our new stable AAP analog Ac-d-Tyr-d-Pro-d-Hyp-Gly-d-Ala-Gly-NH2 (ZP123) with the previously described AAP analog AAP10. Moreover, the effect of the two compounds was examined in a murine in vivo model of ouabain-induced second degree AV-block, and the effect on dispersion of action potential duration (APD dispersion) was studied during hypokalemic-ischemia in isolated perfused rabbit hearts. The in vitro t1/2 of ZP123 in rat and human plasma was about 1,700 times longer than t1/2 of AAP10. Due to rapid elimination, it was not possible to obtain an in vivo pharmacokinetic characterization of AAP10; however, calculations suggested that the clearance of ZP123 was at least 140 times slower than for AAP10. AAP10 and ZP123 produced a dose-dependent delay in onset of ouabain-induced AV-block in mice at doses of 10-11 to 10-7 mol/kg i.v. ZP123 and 10-11 to 10-6 mol/kg i.v. AAP10. Maximal efficacy of ZP123 was reached at a 10-fold lower dose (10-8 mol/kg i.v.) than with AAP10. In the isolated rabbit hearts, ZP123 and AAP10 had no effect on dispersion during control conditions. The increased APD dispersion during hypokalemic ischemia is considered a major arrhythmic substrate and only ZP123 prevented the increase in APD dispersion. In conclusion, ZP123 is a new potent AAP analog with improved stability.


Assuntos
Antiarrítmicos/farmacocinética , Oligopeptídeos/farmacocinética , Potenciais de Ação/efeitos dos fármacos , Animais , Antiarrítmicos/sangue , Estabilidade de Medicamentos , Coração/efeitos dos fármacos , Coração/fisiologia , Hemodinâmica/efeitos dos fármacos , Humanos , Camundongos , Oligopeptídeos/sangue , Oligopeptídeos/farmacologia , Coelhos , Ratos , Fatores de Tempo
SELEÇÃO DE REFERÊNCIAS
DETALHE DA PESQUISA