Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 33
Filtrar
Mais filtros








Intervalo de ano de publicação
1.
Front Physiol ; 13: 1007418, 2022.
Artigo em Inglês | MEDLINE | ID: mdl-36505085

RESUMO

Hutchinson-Gilford Progeria Syndrome (HGPS) is a rare genetic disorder that causes accelerated aging and a high risk of cardiovascular complications. However, the underlying mechanisms of cardiac complications of this syndrome are not fully understood. This study modeled HGPS using cardiomyocytes (CM) derived from induced pluripotent stem cells (iPSC) derived from a patient with HGPS and characterized the biophysical, morphological, and molecular changes found in these CM compared to CM derived from a healthy donor. Electrophysiological recordings suggest that the HGPS-CM was functional and had normal electrophysiological properties. Electron tomography showed nuclear morphology alteration, and the 3D reconstruction of electron tomography images suggests structural abnormalities in HGPS-CM mitochondria, however, there was no difference in mitochondrial content as measured by Mitotracker. Immunofluorescence indicates nuclear morphological alteration and confirms the presence of Troponin T. Telomere length was measured using qRT-PCR, and no difference was found in the CM from HGPS when compared to the control. Proteomic analysis was carried out in a high-resolution system using Liquid Chromatography Tandem Mass Spectrometry (LC-MS/MS). The proteomics data show distinct group separations and protein expression differences between HGPS and control-CM, highlighting changes in ribosomal, TCA cycle, and amino acid biosynthesis, among other modifications. Our findings show that iPSC-derived cardiomyocytes from a Progeria Syndrome patient have significant changes in mitochondrial morphology and protein expression, implying novel mechanisms underlying premature cardiac aging.

2.
J Agric Food Chem ; 70(51): 16218-16228, 2022 Dec 28.
Artigo em Inglês | MEDLINE | ID: mdl-36530137

RESUMO

We investigated changes in the phenolic profile and antioxidant properties in the extracts of developing seeds of açaí (Euterpe oleracea). Four developmental stages were evaluated, with earlier stages displaying higher antioxidant activity and polyphenols content, while mass spectrometry analysis identified procyanidins (PCs) as the major components of the extracts in all stages. B-type PCs varied from dimers to decamers, with A-type linkages in a smaller number. Extracted PCs decreased in average length from 20.5 to 10.1 along seed development. PC composition indicated that (-)-epicatechin corresponded to over 95% of extension units in all stages, while (+)-catechin presence as the starter unit increased from 42 to 78.8% during seed development. This variation was correlated to the abundance of key enzymes for PC biosynthesis during seed development. This study is the first to report PC content and composition variations during açaí seed development, which can contribute to studies on the plant's physiology and biotechnological applications.


Assuntos
Antioxidantes , Euterpe , Antioxidantes/química , Euterpe/química , Fenóis/análise , Sementes/química , Extratos Vegetais/química
3.
Toxins (Basel) ; 14(11)2022 11 19.
Artigo em Inglês | MEDLINE | ID: mdl-36422980

RESUMO

Snake venoms are complex cocktails of non-toxic and toxic molecules that work synergistically for the envenoming outcome. Alongside the immediate consequences, chronic manifestations and long-term sequelae can occur. Recently, extracellular vesicles (EVs) were found in snake venom. EVs mediate cellular communication through long distances, delivering proteins and nucleic acids that modulate the recipient cell's function. However, the biological roles of snake venom EVs, including possible cross-organism communication, are still unknown. This knowledge may expand the understanding of envenoming mechanisms. In the present study, we isolated and characterized the EVs from Bothrops jararaca venom (Bj-EVs), giving insights into their biological roles. Fresh venom was submitted to differential centrifugation, resulting in two EV populations with typical morphology and size range. Several conserved EV markers and a subset of venom related EV markers, represented mainly by processing enzymes, were identified by proteomic analysis. The most abundant protein family observed in Bj-EVs was 5'-nucleotidase, known to be immunosuppressive and a low abundant and ubiquitous toxin in snake venoms. Additionally, we demonstrated that mammalian cells efficiently internalize Bj-EVs. The commercial antibothropic antivenom partially recognizes Bj-EVs and inhibits cellular EV uptake. Based on the proteomic results and the in vitro interaction assays using macrophages and muscle cells, we propose that Bj-EVs may be involved not only in venom production and processing but also in host immune modulation and long-term effects of envenoming.


Assuntos
Bothrops , Venenos de Crotalídeos , Vesículas Extracelulares , Animais , Venenos de Crotalídeos/química , Proteômica , Proteínas , Venenos de Serpentes , Mamíferos
4.
Sci Rep ; 12(1): 15931, 2022 09 23.
Artigo em Inglês | MEDLINE | ID: mdl-36151245

RESUMO

Testosterone is a hormone that plays a key role in carbohydrate, fat, and protein metabolism. Testosterone deficiency is associated with multiple comorbidities, e.g., metabolic syndrome and type 2 diabetes. Despite its importance in many metabolic pathways, the mechanisms by which it controls metabolism are not fully understood. The present study investigated the short-term metabolic changes of pharmacologically induced castration and, subsequently, testosterone supplementation in healthy young males. Thirty subjects were submitted to testosterone depletion (TD) followed by testosterone supplementation (TS). Plasma samples were collected three times corresponding to basal, low, and restored testosterone levels. An untargeted metabolomics study was performed by liquid chromatography-high resolution mass spectrometry (UHPLC-HRMS) to monitor the metabolic changes induced by the altered hormone levels. Our results demonstrated that TD was associated with major metabolic changes partially restored by TS. Carnitine and amino acid metabolism were the metabolic pathways most impacted by variations in testosterone. Furthermore, our results also indicated that LH and FSH might strongly alter the plasma levels of indoles and lipids, especially glycerophospholipids and sphingolipids. Our results demonstrated major metabolic changes induced by low testosterone that may be important for understanding the mechanisms behind the association of testosterone deficiency and its comorbidities.


Assuntos
Infertilidade Masculina , Metaboloma , Testosterona , Aminoácidos/metabolismo , Carboidratos , Carnitina , Suplementos Nutricionais , Hormônio Foliculoestimulante , Glicerofosfolipídeos , Humanos , Indóis , Infertilidade Masculina/induzido quimicamente , Lipídeos , Hormônio Luteinizante , Masculino , Esfingolipídeos , Testosterona/farmacologia
5.
Front Cell Infect Microbiol ; 12: 900608, 2022.
Artigo em Inglês | MEDLINE | ID: mdl-35873163

RESUMO

Zika is a vector-borne disease caused by an arbovirus (ZIKV) and overwhelmingly transmitted by Ae. aegypti. This disease is linked to adverse fetal outcomes, mostly microcephaly in newborns, and other clinical aspects such as acute febrile illness and neurologic complications, for example, Guillain-Barré syndrome. One of the most promising strategies to mitigate arbovirus transmission involves releasing Ae. aegypti mosquitoes carrying the maternally inherited endosymbiont bacteria Wolbachia pipientis. The presence of Wolbachia is associated with a reduced susceptibility to arboviruses and a fitness cost in mosquito life-history traits such as fecundity and fertility. However, the mechanisms by which Wolbachia influences metabolic pathways leading to differences in egg production remains poorly known. To investigate the impact of coinfections on the reproductive tract of the mosquito, we applied an isobaric labeling-based quantitative proteomic strategy to investigate the influence of Wolbachia wMel and ZIKV infection in Ae. aegypti ovaries. To the best of our knowledge, this is the most complete proteome of Ae. aegypti ovaries reported so far, with a total of 3913 proteins identified, were also able to quantify 1044 Wolbachia proteins in complex sample tissue of Ae. aegypti ovary. Furthermore, from a total of 480 mosquito proteins modulated in our study, we discuss proteins and pathways altered in Ae. aegypti during ZIKV infections, Wolbachia infections, coinfection Wolbachia/ZIKV, and compared with no infection, focusing on immune and reproductive aspects of Ae. aegypti. The modified aspects mainly were related to the immune priming enhancement by Wolbachia presence and the modulation of the Juvenile Hormone pathway caused by both microorganism's infection.


Assuntos
Aedes , Coinfecção , Wolbachia , Infecção por Zika virus , Zika virus , Aedes/microbiologia , Animais , Feminino , Humanos , Recém-Nascido , Mosquitos Vetores , Ovário , Proteômica
6.
Biomater Adv ; 133: 112642, 2022 Feb.
Artigo em Inglês | MEDLINE | ID: mdl-35034821

RESUMO

Organ decellularization is one of the most promising approaches of tissue engineering to overcome the shortage of organs available for transplantation. However, there are key hurdles that still hinder its clinical application, and the lack of hemocompatibility of decellularized materials is a central one. In this work, we demonstrate that Custodiol (HTK solution), a common solution used in organ transplantation, increased the hemocompatibility of acellular scaffolds obtained from rat livers. We showed that Custodiol inhibited ex vivo, in vitro, and in vivo blood coagulation to such extent that allowed successful transplantation of whole-liver scaffolds into recipient animals. Scaffolds previously perfused with Custodiol showed no signs of platelet aggregation and maintained in vitro and in vivo cellular compatibility. Proteomic analysis revealed that proteins related to platelet aggregation were reduced in Custodiol samples while control samples were enriched with thrombogenicity-related proteins. We also identified distinct components that could potentially be involved with this anti-thrombogenic effect and thus require further investigation. Therefore, Custodiol perfusion emerge as a promising strategy to reduce the thrombogenicity of decellularized biomaterials and could benefit several applications of whole-organ tissue engineering.


Assuntos
Proteômica , Engenharia Tecidual , Animais , Glucose , Fígado , Manitol , Perfusão , Cloreto de Potássio , Procaína , Ratos
8.
Life (Basel) ; 11(11)2021 Nov 22.
Artigo em Inglês | MEDLINE | ID: mdl-34833152

RESUMO

Long term effect of testosterone (T) deficiency impairs metabolism and is associated with muscle degradation and metabolic disease. The association seems to have a bidirectional nature and is not well understood. The present study aims to investigate the early and unidirectional metabolic effect of induced T changes by measuring fasting amino acid (AA) levels in a human model, in which short-term T alterations were induced. We designed a human model of 30 healthy young males with pharmacologically induced T changes, which resulted in three time points for blood collection: (A) baseline, (B) low T (3 weeks post administration of gonadotropin releasing hormone antagonist) and (C) restored T (2 weeks after injection of T undecanoate). The influence of T on AAs was analyzed by spectrophotometry on plasma samples. Levels of 9 out of 23 AAs, of which 7 were essential AAs, were significantly increased at low T and are restored upon T supplementation. Levels of tyrosine and phenylalanine were most strongly associated to T changes. Short-term effect of T changes suggests an increased protein breakdown that is restored upon T supplementation. Fasting AA levels are able to monitor the early metabolic changes induced by the T fluctuations.

9.
Front Physiol ; 12: 642237, 2021.
Artigo em Inglês | MEDLINE | ID: mdl-33716790

RESUMO

Zika virus (ZIKV) is a global public health emergency due to its association with microcephaly, Guillain-Barré syndrome, neuropathy, and myelitis in children and adults. A total of 87 countries have had evidence of autochthonous mosquito-borne transmission of ZIKV, distributed across four continents, and no antivirus therapy or vaccines are available. Therefore, several strategies have been developed to target the main mosquito vector, Aedes aegypti, to reduce the burden of different arboviruses. Among such strategies, the use of the maternally-inherited endosymbiont Wolbachia pipientis has been applied successfully to reduce virus susceptibility and decrease transmission. However, the mechanisms by which Wolbachia orchestrate resistance to ZIKV infection remain to be elucidated. In this study, we apply isobaric labeling quantitative mass spectrometry (MS)-based proteomics to quantify proteins and identify pathways altered during ZIKV infection; Wolbachia infection; co-infection with Wolbachia/ZIKV in the A. aegypti heads and salivary glands. We show that Wolbachia regulates proteins involved in reactive oxygen species production, regulates humoral immune response, and antioxidant production. The reduction of ZIKV polyprotein in the presence of Wolbachia in mosquitoes was determined by MS and corroborates the idea that Wolbachia helps to block ZIKV infections in A. aegypti. The present study offers a rich resource of data that may help to elucidate mechanisms by which Wolbachia orchestrate resistance to ZIKV infection in A. aegypti, and represents a step further on the development of new targeted methods to detect and quantify ZIKV and Wolbachia directly in complex tissues.

10.
Plant Methods ; 17(1): 15, 2021 Feb 06.
Artigo em Inglês | MEDLINE | ID: mdl-33549129

RESUMO

BACKGROUND: Casbene synthase (CS) is responsible for the first committed step in the biosynthesis of phorbol esters (PE) in the Euphorbiaceae. PE are abundant in the seeds of the biofuel crop Jatropha curcas and its toxicity precludes the use of the protein-rich cake obtained after oil extraction as an animal feed and the toxicity of the fumes derived from burning PE containing biofuel is also a matter of concern. This toxicity is a major hindrance to exploit the potential of this crop as a source of raw material to produce biodiesel. For this reason, the current research on J. curcas is mainly focused on the understanding of the biosynthesis and site of synthesis of PE, as an avenue for the development of genotypes unable to synthesize PE in its seeds. RESULTS: Here, we present targeted proteomics assays (SRM and PRM) to detect and quantify CS in leaves, endosperm, and roots of two J. curcas genotypes with contrasting levels of PE. These assays were based on the use of reference isotopic labeled synthetic peptides (ILSP) predicted from 12 gene models of CS from the J. curcas genome. CONCLUSION: Our targeted proteomics methods were able to detect and quantify, for the first time, CS gene products and demonstrate the distribution of CS isoforms only in roots from J. curcas genotypes with a high and low concentration of PE. These methods can be expanded to monitor CS, at the protein level, in different tissues and genotypes of J. curcas.

11.
Metabolomics ; 15(7): 100, 2019 06 28.
Artigo em Inglês | MEDLINE | ID: mdl-31254107

RESUMO

INTRODUCTION: Hutchinson-Gilford Progeria Syndrome (HGPS) is an extremely rare genetic disorder. HGPS children present a high incidence of cardiovascular complications along with altered metabolic processes and an accelerated aging process. No metabolic biomarker is known and the mechanisms underlying premature aging are not fully understood. OBJECTIVES: The present work aims to evaluate the metabolic alterations in HGPS using high resolution mass spectrometry. METHODS: The present study analyzed plasma from six HGPS patients of both sexes (7.7 ± 1.4 years old; mean ± SD) and eight controls (8.6 ± 2.3 years old) by LC-MS/MS in high-resolution non-targeted metabolomics (Q-Exactive Plus). Targeted metabolomics was used to validate some of the metabolites identified by the non-targeted method in a triple quadrupole (TSQ-Quantiva). RESULTS: We found several endogenous metabolites with statistical differences between control and HGPS children. Multivariate statistical analysis showed a clear separation between groups. Potential novel metabolic biomarkers were identified using the multivariate area under ROC curve (AUROC) based analysis, showing an AUC value higher than 0.80 using only two metabolites, and tending to 1.00 when increasing the number of metabolites in the AUROC model. Taken together, changed metabolic pathways involve sphingolipids, amino acids, and oxidation of fatty acids, among others. CONCLUSION: Our data show significant alterations in cellular energy use and availability, in signal transduction, and lipid metabolites, adding new insights on metabolic alterations associated with premature aging and suggesting novel putative biomarkers.


Assuntos
Metaboloma , Metabolômica/métodos , Progéria/metabolismo , Senilidade Prematura , Aminoácidos/metabolismo , Área Sob a Curva , Biomarcadores/sangue , Estudos de Casos e Controles , Criança , Cromatografia Líquida de Alta Pressão , Análise Discriminante , Ácidos Graxos/química , Ácidos Graxos/metabolismo , Humanos , Análise dos Mínimos Quadrados , Análise de Componente Principal , Progéria/patologia , Curva ROC , Esfingolipídeos/metabolismo
12.
Virulence ; 9(1): 818-836, 2018 12 31.
Artigo em Inglês | MEDLINE | ID: mdl-29560793

RESUMO

Acanthamoeba castellanii (Ac) are ubiquitously distributed in nature, and by contaminating medical devices such as heart valves and contact lenses, they cause a broad range of clinical presentations to humans. Although several molecules have been described to play a role in Ac pathogenesis, including parasite host-tissue invasion and escaping of host-defense, little information is available on their mechanisms of secretion. Herein, we describe the molecular components secreted by Ac, under different protein availability conditions to simulate host niches. Ac extracellular vesicles (EVs) were morphologically and biochemically characterized. Dynamic light scattering analysis of Ac EVs identified polydisperse populations, which correlated to electron microscopy measurements. High-performance thin liquid chromatography of Ac EVs identified phospholipids, steryl-esters, sterol and free-fatty acid, the last two also characterized by GC-MS. Secretome composition (EVs and EVs-free supernatants) was also determined and proteins biological functions classified. In peptone-yeast-glucose (PYG) medium, a total of 179 proteins were identified (21 common proteins, 89 exclusive of EVs and 69 in EVs-free supernatant). In glucose alone, 205 proteins were identified (134 in EVs, 14 common and 57 proteins in EVs-free supernatant). From those, stress response, oxidative and protein and amino acid metabolism proteins prevailed. Qualitative differences were observed on carbohydrate metabolism enzymes from Krebs cycle and pentose phosphate shunt. Serine proteases and metalloproteinases predominated. Analysis of the cytotoxicity of Ac EVs (upon uptake) and EVs-free supernatant to epithelial and glioblastoma cells revealed a dose-dependent effect. Therefore, the Ac secretome differs depending on nutrient conditions, and is also likely to vary during infection.


Assuntos
Acanthamoeba castellanii/metabolismo , Amebíase/parasitologia , Vesículas Extracelulares/metabolismo , Proteoma/metabolismo , Proteínas de Protozoários/metabolismo , Acanthamoeba castellanii/genética , Animais , Linhagem Celular , Vesículas Extracelulares/genética , Homeostase , Humanos , Transporte Proteico , Proteoma/genética , Proteômica , Proteínas de Protozoários/genética , Via Secretória
13.
Adv Exp Med Biol ; 974: 219-227, 2017.
Artigo em Inglês | MEDLINE | ID: mdl-28353239

RESUMO

Shotgun proteomics has been used successfully for more than two decades for measurement of proteins from diverse biological systems. This has led to new insights and identification of potential biomarkers and drug targets for numerous medical conditions. The advent of mass-labeling approaches such as isobaric tagging for relative and absolute quantitation (iTRAQ) has allowed multiplexing of samples to improve the accuracy and throughput of experiments and the reduction of costs. Here, we describe a detailed iTRAQ mass spectrometry protocol for simultaneous analysis of four proteomes from postmortem brain tissue extracts. In addition, a post-labeling procedure for peptide fractionation is presented.


Assuntos
Química Encefálica , Transtornos Mentais/metabolismo , Proteínas do Tecido Nervoso/análise , Espectrometria de Massas em Tandem/métodos , Biomarcadores/análise , Cromatografia Líquida/métodos , Humanos , Peso Molecular , Nanotecnologia/métodos , Proteínas do Tecido Nervoso/isolamento & purificação , Fragmentos de Peptídeos/análise , Espectrometria de Massas por Ionização por Electrospray/métodos , Coloração e Rotulagem/métodos
14.
Methods Mol Biol ; 1546: 267-274, 2017.
Artigo em Inglês | MEDLINE | ID: mdl-27896776

RESUMO

Shotgun proteomics has a key role in quantitative estimation of proteins from biological systems under different conditions, which is crucial in the understanding of their functional roles. Isobaric tagging for relative and absolute quantitation (iTRAQ) mass spectrometry is based on pre-labeling of peptides with mass tags which allows the multiplex analysis of up to eight proteomes simultaneously. We describe here a detailed protocol for sample preparation and iTRAQ 4-plex labeling for relative quantification of multiple samples from human and plant tissues. We also present two strategies for peptide fractionation after the iTRAQ labeling protocol.


Assuntos
Marcação por Isótopo , Proteoma , Proteômica/métodos , Espectrometria de Massas em Tandem , Fracionamento Químico , Humanos , Peptídeos/química , Software , Espectrometria de Massas em Tandem/métodos
15.
J Proteome Res ; 13(4): 1810-22, 2014 Apr 04.
Artigo em Inglês | MEDLINE | ID: mdl-24593137

RESUMO

The present work aims at characterizing T. harzianum secretome when the fungus is grown in synthetic medium supplemented with one of the four substrates: glucose, cellulose, xylan, and sugarcane bagasse (SB). The characterization was done by enzymatic assays and proteomic analysis using 2-DE/MALDI-TOF and gel-free shotgun LC-MS/MS. The results showed that SB induced the highest cellulolytic and xylanolytic activities when compared with the other substrates, while remarkable differences in terms of number and distribution of protein spots in 2-DE gels were also observed among the samples. Additionally, treatment of the secretomes with PNGase F revealed that most spot trails in 2-DE gels corresponded to N-glycosylated proteoforms. The LC-MS/MS analysis of the samples identified 626 different protein groups, including carbohydrate-active enzymes and accessory, noncatalytic, and cell-wall-associated proteins. Although the SB-induced secretome displayed the highest cellulolytic and xylanolytic activities, it did not correspond to a higher proteome complexity because CM-cellulose-induced secretome was significantly more diverse. Among the identified proteins, 73% were exclusive to one condition, while only 5% were present in all samples. Therefore, this study disclosed the variation of T. harzianum secretome in response to different substrates and revealed the diversity of the fungus enzymatic toolbox.


Assuntos
Biomassa , Proteínas Fúngicas/análise , Proteoma/análise , Trichoderma/enzimologia , Trichoderma/metabolismo , Celulase , Celulose , Proteínas Fúngicas/química , Proteínas Fúngicas/metabolismo , Mapeamento de Peptídeos , Proteoma/química , Proteoma/metabolismo , Proteômica/métodos , Trichoderma/química , Trichoderma/fisiologia
16.
Parasit Vectors ; 5: 290, 2012 Dec 11.
Artigo em Inglês | MEDLINE | ID: mdl-23232105

RESUMO

BACKGROUND: Aedes albopictus is a vector for several fatal arboviruses in tropical and sub-tropical regions of the world. The midgut of the mosquito is the first barrier that pathogens must overcome to establish infection and represents one of the main immunologically active sites of the insect. Nevertheless, little is known about the proteins involved in the defense against pathogens, and even in the processing of food, and the detoxification of metabolites. The identification of proteins exclusively expressed in the midgut is the first step in understanding the complex physiology of this tissue and can provide insight into the mechanisms of pathogen-vector interaction. However, identification of the locally expressed proteins presents a challenge because the Ae. albopictus genome has not been sequenced. METHODS: In this study, two-dimensional electrophoresis (2DE) was combined with liquid chromatography in line with tandem mass spectrometry (LC-MS/MS) and data mining to identify the major proteins in the midgut of sugar-fed Ae. albopictus females. RESULTS: Fifty-six proteins were identified by sequence similarity to entries from the Ae. aegypti genome. In addition, two hypothetical proteins were experimentally confirmed. According to the gene ontology analysis, the identified proteins were classified into 16 clusters of biological processes. Use of the STRING database to investigate protein functional associations revealed five functional networks among the identified proteins, including a network for carbohydrate and amino acid metabolism, a group associated with ATP production and a network of proteins that interact during detoxification of toxic free radicals, among others. This analysis allowed the assignment of a potential role for proteins with unknown function based on their functional association with other characterized proteins. CONCLUSION: Our findings represent the first proteome map of the Ae. albopictus midgut and denotes the first steps towards the description of a comprehensive proteome map of this vector. In addition, the data contributes to the functional annotation of Aedes spp. genomes using mass spectrometry-based proteomics data combined with complementary gene prediction methods.


Assuntos
Aedes/química , Carboidratos/administração & dosagem , Dieta/métodos , Proteínas de Insetos/biossíntese , Proteoma/análise , Animais , Cromatografia Líquida , Biologia Computacional , Eletroforese em Gel Bidimensional , Feminino , Trato Gastrointestinal/química , Espectrometria de Massas em Tandem
17.
Ciênc. cogn ; 17(2): 76-97, jul. 2012. ilus, tab
Artigo em Português | LILACS, Index Psicologia - Periódicos | ID: lil-677991

RESUMO

A partir do estudo da epistemologia de Bachelard na disciplina Lógica e Filosofia da Ciência da Pós-Graduação em Bioquímica do Instituto de Química/Universidade Federal do Rio de Janeiro (IQ/UFRJ), buscou-se identificar obstáculos epistemológicos entre pós-graduandos em bioquímica e áreas correlatas. Um questionário com perguntas e excertos de artigos científicos de revistas de alto fator de impacto foi respondido, anonimamente, por pós-graduandos de diferentes cursos da UFRJ e de outras universidades, que nunca cursaram disciplina relacionada à epistemologia. Foi possível identificar concepções vitalistas (animismo) tanto nas respostas às perguntas como na aceitação ou não identificação deste obstáculo nos excertos. O obstáculo pragmático e unitário foi identificado através de uma concepção teleológica dos processos evolutivos, em afirmações como a existência de objetivos/finalidades na adaptação dos organismos. Verificou-se a presença de figuras de linguagem, metáforas e analogias (obstáculo verbal) na explicação da evolução e do sistema imune, também encontradas nos excertos dos artigos. Foram também identificados obstáculos associados à observação primeira e generalização prematura. A partir deste diagnóstico verificou-se a necessidade de enfatizar o caráter objetivo, material, não teleológico da bioquímica, em disciplinas oferecidas desde a graduação.


Assuntos
Humanos , Religião , Bioquímica , Comportamento Verbal
18.
Cienc. cogn ; 17(2): 76-97, jul. 2012. ilus, tab
Artigo em Português | Index Psicologia - Periódicos | ID: psi-56792

RESUMO

A partir do estudo da epistemologia de Bachelard na disciplina Lógica e Filosofia da Ciência da Pós-Graduação em Bioquímica do Instituto de Química/Universidade Federal do Rio de Janeiro (IQ/UFRJ), buscou-se identificar obstáculos epistemológicos entre pós-graduandos em bioquímica e áreas correlatas. Um questionário com perguntas e excertos de artigos científicos de revistas de alto fator de impacto foi respondido, anonimamente, por pós-graduandos de diferentes cursos da UFRJ e de outras universidades, que nunca cursaram disciplina relacionada à epistemologia. Foi possível identificar concepções vitalistas (animismo) tanto nas respostas às perguntas como na aceitação ou não identificação deste obstáculo nos excertos. O obstáculo pragmático e unitário foi identificado através de uma concepção teleológica dos processos evolutivos, em afirmações como a existência de objetivos/finalidades na adaptação dos organismos. Verificou-se a presença de figuras de linguagem, metáforas e analogias (obstáculo verbal) na explicação da evolução e do sistema imune, também encontradas nos excertos dos artigos. Foram também identificados obstáculos associados à observação primeira e generalização prematura. A partir deste diagnóstico verificou-se a necessidade de enfatizar o caráter objetivo, material, não teleológico da bioquímica, em disciplinas oferecidas desde a graduação


Assuntos
Humanos , Religião , Bioquímica , Comportamento Verbal
19.
Proteomics ; 12(17): 2729-38, 2012 Aug.
Artigo em Inglês | MEDLINE | ID: mdl-22744980

RESUMO

Plant cell wall-degrading enzymes produced by microorganisms possess important biotechnological applications, including biofuel production. Some anaerobic bacteria are able to produce multienzymatic complexes called cellulosomes while filamentous fungi normally secrete individual hydrolytic enzymes that act synergistically for polysaccharide degradation. Here, we present evidence that the fungus Trichoderma harzianum, cultivated in medium containing the agricultural residue sugarcane bagasse, is able to secrete multienzymatic complexes. The T. harzianum secretome was firstly analyzed by 1D-BN (blue native)-PAGE that revealed several putative complexes. The three most intense 1D-BN-PAGE bands, named complexes [I], [II], and [III], were subsequently subjected to tricine SDS-PAGE that demonstrated that they were composed of smaller subunits. Zymographic assays were performed using 1D-BN-PAGE and 2D-BN/BN-PAGE demonstrating that the complexes bore cellulolytic and xylanolytic activities. The complexes [I], [II], and [III] were then trypsin digested and analyzed separately by LC-MS/MS that revealed their protein composition. Since T. harzianum has an unsequenced genome, a homology-driven proteomics approach provided a higher number of identified proteins than a conventional peptide-spectrum matching strategy. The results indicate that the complexes are formed by cellulolytic and hemicellulolytic enzymes and other proteins such as chitinase, cutinase, and swollenin, which may act synergistically to degrade plant cell wall components.


Assuntos
Celulases/metabolismo , Glicosídeo Hidrolases/metabolismo , Complexos Multienzimáticos/metabolismo , Trichoderma/enzimologia , Eletroforese em Gel Bidimensional , Eletroforese em Gel de Poliacrilamida , Proteínas Fúngicas/metabolismo , Proteoma/metabolismo , Proteômica/métodos , Saccharum/microbiologia , Espectrometria de Massas em Tandem/métodos , Trichoderma/metabolismo
20.
Plant Physiol Biochem ; 49(7): 738-43, 2011 Jul.
Artigo em Inglês | MEDLINE | ID: mdl-21334906

RESUMO

A protein, similar to osmotin- and thaumatin-like proteins, was purified from Calotropis procera (Ait.) R.Br latex. The isolation procedure required two cation exchange chromatography steps on 50mM Na-acetate buffer (pH 5.0) CM-Sepharose Fast Flow and 25 mM Na-phosphate buffer (pH 6.0) Resource-S, respectively. The protein purity was confirmed by an unique N-terminal sequence [ATFTIRNNCPYTIWAAAVPGGGRRLNSGGTWTINVAPGTA]. The osmotin (CpOsm) appeared as a single band (20,100 Da) in sodium dodecyl sulfate-polyacrylamide gel electrophoresis and as two spots in two-dimensional electrophoresis (pI 8.9 and 9.1). Both polypeptides were further identified by mass spectrometry as two osmotin isoforms with molecular masses of 22,340 and 22,536 Da. The CpOsm exerted antifungal activity against Fusarium solani (IC50=67.0 µg mL⁻¹), Neurospora sp. (IC50=57.5 µg mL⁻¹) and Colletotrichum gloeosporioides (IC50=32.1 µg mL⁻¹). However, this activity was lost when the protein was previously treated with a reducing agent (DTT, Dithiothreitol) suggesting the presence of disulfide bounds stabilizing the protein. The occurrence of osmotin in latex substantiates the defensive role of these fluids.


Assuntos
Antifúngicos/metabolismo , Calotropis/metabolismo , Látex/metabolismo , Proteínas de Plantas/metabolismo , Sequência de Aminoácidos , Antifúngicos/química , Antifúngicos/isolamento & purificação , Antifúngicos/farmacologia , Calotropis/química , Colletotrichum/efeitos dos fármacos , Eletroforese em Gel Bidimensional , Eletroforese em Gel de Poliacrilamida , Fusarium/efeitos dos fármacos , Glicoproteínas/química , Glicoproteínas/isolamento & purificação , Glicoproteínas/metabolismo , Glicoproteínas/farmacologia , Látex/química , Espectrometria de Massas , Peso Molecular , Neurospora/efeitos dos fármacos , Imunidade Vegetal , Proteínas de Plantas/química , Proteínas de Plantas/isolamento & purificação , Proteínas de Plantas/farmacologia , Isoformas de Proteínas , Espectrometria de Massas por Ionização e Dessorção a Laser Assistida por Matriz
SELEÇÃO DE REFERÊNCIAS
DETALHE DA PESQUISA