Your browser doesn't support javascript.
loading
Show: 20 | 50 | 100
Results 1 - 20 de 114
Filter
1.
Ciênc. Saúde Colet. (Impr.) ; 20(1): 165-174, jan. 2015. tab
Article in Portuguese | LILACS | ID: lil-733139

ABSTRACT

O objetivo deste artigo é investigar relações entre renda e escolaridade com condições de saúde e nutrição em obesos graves. Estudo transversal ambulatorial com 79 pacientes de primeira consulta, com Índice de Massa Corporal (IMC) ≥ 35 kg/m2 e idade ≥ 20 anos. Coletaram-se dados: sociodemográficos, antropométricos, estilo de vida, exames bioquímicos e consumo alimentar. O IMC médio foi 48,3 ± 6,9 kg/m2. Observou-se correlação negativa significante de escolaridade com variáveis peso (r = -0,234) e IMC (r = -0,364) e de renda familiar per capita com consumo diário de vegetal A (r = -0,263). Após análise multivariada maior renda familiar per capita se associou à ausência de cardiopatia (RP: 0,51, IC95%: 0,32-0,81), maior consumo diário de vegetal A (RP: 1,79, IC95%: 1,16-2,75) e doces (RP: 3,12, IC95%: 1,21-8,04). Em obesos graves a maior renda familiar per capita se associou à ausência de cardiopatia e maior consumo de vegetais folhosos e doces. Já a escolaridade não se manteve associada às condições de saúde e nutrição.


This article seeks to investigate the relationship between income and educational level and health and nutritional conditions among the morbidly obese. A cross-sectional study was conducted with 79 patients at first appointment, with Body Mass Index (BMI) ≥ 35 kg/m2 and age ≥ 20 years. The following data was collected: demographic, socioeconomic, anthropometric, lifestyle, biochemical and food intake data. Average BMI was 48.3 ± 6.9 kg/m2. There was a significant negative correlation between education level and the variables of weight (r = -0.234) and BMI (r = -0.364) and per capita family income with daily consumption of leafy vegetables (r = -0.263). After multivariate analysis, higher per capita family income was associated with the absence of heart disease (PR: 0.51, CI95%: 0.32-0.81), higher daily consumption of leafy vegetables (PR: 1.79, CI95%: 1.16-2.75) and candy (PR: 3.12, CI95%: 1.21-8.04). In the morbidly obese, per capita household income was associated with absence of heart disease and higher consumption of leafy vegetables and candy. On the other hand, education level was not associated with health and nutrition conditions.


Subject(s)
Arabidopsis/enzymology , Arabidopsis/genetics , Gene Expression Regulation, Plant , Indoleacetic Acids/metabolism , Phospholipases A/metabolism , /pharmacology , /pharmacology , Arabidopsis Proteins/genetics , Arabidopsis Proteins/metabolism , DNA-Binding Proteins/genetics , DNA-Binding Proteins/metabolism , Enzyme Inhibitors/pharmacology , Glucuronidase/metabolism , Luciferases/metabolism , Nuclear Proteins/genetics , Nuclear Proteins/metabolism , Phospholipases A/antagonists & inhibitors , Protein Processing, Post-Translational/drug effects , RNA, Messenger/genetics , RNA, Messenger/metabolism , Seedlings/drug effects , Seedlings/metabolism , Time Factors
2.
J. venom. anim. toxins incl. trop. dis ; 21: 1-8, 31/03/2015. graf, tab
Article in English | LILACS, VETINDEX | ID: biblio-1484622

ABSTRACT

Background: Microbial/bacterial resistance against antibiotics poses a serious threat to public health. Furthermore, the side effects of these antibiotics have stimulated tremendous interest in developing new molecules from diverse organisms as therapeutic agents. This study evaluates the antibacterial potential of a basic protein, Vipera russellii venom phospholipase A2 fraction VIIIa (VRV-PL-VIIIa), from Daboia russelii pulchella venom against gram-positive and gram-negative bacteria. Methods: The antibacterial potential of VRV-PL-VIIIa in the presence and absence of an inhibitor (p-bromophenacyl bromide) was tested against gram-positive and gram-negative bacteria and the minimum inhibitory concentration was determined by microdilution tests. Results: VRV-PL-VIIIa demonstrated potent antibacterial activities against all the human pathogenic strains tested. It more effectively inhibited such gram-positive bacteria as Staphylococcus aureus and Bacillus subtilis, when compared to the gram-negative bacteria Escherichia coli, Vibrio cholerae, Klebsiella pneumoniae and Salmonella paratyphi. It inhibited bacterial growth at minimum inhibitory concentration values ranging from 11.1 to 19.2 μg/mL. The anti-bacterial potential of VRV-PL-VIIIa was comparable to the standards gentamycin, chlorophenicol and streptomycin. The PLA2's hemolytic and antibacterial activities were strongly correlated. Furthermore, even in the presence of p-bromophenacyl bromide, intense antibacterial activity was observed, suggesting a dissociation or partial overlapping of the bactericidal/antimicrobial domains. Conclusion: VRV-PL-VIIIa demonstrated potent antibacterial activities against all the human pathogenic strains tested. The study shows that despite a strong correlation between enzymatic and antimicrobial activities of VRV-PL-VIIIa, it may possess additional properties that mimic the bactericidal/membrane permeability-increasing protein. This study encourages further in-depth studies on the molecular mechanisms of antibacterial properties of VRV-PL-VIIIa, which would thereby facilitate development of this protein into a possible therapeutic lead molecule for treating bacterial infections.


Subject(s)
Animals , Animals, Poisonous , Anti-Bacterial Agents , Phospholipases A , Viper Venoms , Daboia
3.
J. venom. anim. toxins incl. trop. dis ; 21: 44, 31/03/2015. graf
Article in English | LILACS, VETINDEX | ID: biblio-954769

ABSTRACT

Background Phospholipases A 2 (PLA 2 s) are abundant components of snake venoms that have been extensively studied due to their pharmacological and pathophysiological effects on living organisms. This study aimed to assess the antitumor potential of BthTX-I, a basic myotoxic PLA 2isolated from Bothrops jararacussu venom, by evaluating in vitro processes of cytotoxicity, modulation of the cell cycle and induction of apoptosis in human (HL-60 and HepG2) and murine (PC-12 and B16F10) tumor cell lines. Methods The cytotoxic effects of BthTX-I were evaluated on the tumor cell lines HL-60 (promyelocytic leukemia), HepG2 (human hepatocellular carcinoma), PC-12 (murine pheochromocytoma) and B16F10 (murine melanoma) using the MTT method. Flow cytometry technique was used for the analysis of cell cycle alterations and death mechanisms (apoptosis and/or necrosis) induced in tumor cells after treatment with BthTX-I. Results It was observed that BthTX-I was cytotoxic to all evaluated tumor cell lines, reducing their viability in 40 to 50 %. The myotoxin showed modulating effects on the cell cycle of PC-12 and B16F10 cells, promoting delay in the G0/G1 phase. Additionally, flow cytometry analysis indicated cell death mainly by apoptosis. B16F10 was more susceptible to the effects of BthTX-I, with ~40 % of the cells analyzed in apoptosis, followed by HepG2 (~35 %), PC-12 (~25 %) and HL-60 (~4 %). Conclusions These results suggest that BthTX-I presents antitumor properties that may be useful for developing new therapeutic strategies against cancer.(AU)


Subject(s)
Animals , Phospholipases A , Snake Venoms , Cell Cycle , Bothrops , Cell Line, Tumor , In Vitro Techniques
4.
Rev. bras. enferm ; 67(6): 920-927, Nov-Dec/2014.
Article in Portuguese | LILACS, BDENF | ID: lil-732823

ABSTRACT

Este estudo objetivou compreender as práticas de cuidado dos profissionais de saúde que assistem os idosos Kaingang. Estudo qualitativo, apoiado na etnografia, realizado com dez profissionais à que atuam na atenção primária saúde da Terra Indígena Faxinal, Paraná, Brasil. Os dados foram coletados no período de novembro de 2010 a fevereiro de 2012 por meio da observação participante e entrevistas, e, analisados à luz da Teoria Transcultural do Cuidado. Identificaram-se como práticas de cuidado a medicação e imunização, bem como, cuidados da medicina tradicional. Para realização destes cuidados, os profissionais dispunham de estratégias que proporcionavam manutenção dos idosos na assistência. Conclui-se que valores culturais e científicos necessitam integrar a assistência para melhoria da saúde dos idosos indígenas.


This research aims to understand the care practices of health professionals who assist the elderly Kaingang. It is a qualitative study, supported in ethnography, conducted by ten professionals working in primary health care in the indigenous land of Faxinal, Paraná, Brazil. The data was collected from November 2010 to February 2012 by participant observation and interviews, and analyzed based on the Transcultural Care Theory. Was identified the preoccupation of the carers practices with the medication and immunization, as well as traditional medical care. To achieve these, care professionals had strategies that implemented maintenance of older people in care. We conclude that cultural values and integrate scientific need assistance to improve the health of elderly indigenous.


Este estudio tuvo como objetivo entender las prácticas de cuidado de los profesionales de la salud que asisten a los ancianos Kaingang. Estudio cualitativo, apoyado en la etnografía, llevado a cabo con diez profesionales que trabajan en la atención primaria de la salud de la tierra indígena de Faxinal, Paraná, Brasil. Los datos fueron recogidos a partir de noviembre 2010 a febrero 2012 a través de la observación participante y las entrevistas, y analizado con base en la Teoría del Cuidado Transcultural. Se identificaron las prácticas de atención médica y imunizacion,el cuidado de la medicina, así tradicional. Para lograrlo, los profesionales tenían estrategias que proporcionaban el mantenimiento de las personas mayores en su atención. Se concluye que los valores culturales y científicos necesitan ayuda para mejorar la salud de los ancianos indígenas.


Subject(s)
Animals , Rats , Liver/enzymology , Lysosomes/enzymology , Phospholipases A/metabolism , Phospholipases/metabolism , Protease Inhibitors/pharmacology , Cells, Cultured , Chymotrypsin/antagonists & inhibitors , Cysteine Proteinase Inhibitors/pharmacology , Leucine/analogs & derivatives , Leucine/pharmacology , Leupeptins/pharmacology , Oligopeptides/pharmacology , Pepstatins/pharmacology , Phospholipases A1 , Time Factors
5.
São Paulo; s.n; 2011. 156 p.
Thesis in Portuguese | LILACS | ID: lil-643271

ABSTRACT

Introdução: A obesidade se caracteriza como um processo oxidativo e inflamatório, que predispõe adolescentes, de modo precoce, a eventos até recentemente pouco frequentes nessa faixa etária. Assim, a ação da enzima Fosfolipase A associada às lipoproteínas (Lp-PLA ), que reduz fosfolipídios oxidados e gera lisofosfolipídios, bem como a disponibilidade de antioxidantes plasmáticos, representam um importante tema de pesquisa no contexto cardiovascular. Objetivo: Verificar se a atividade da LP-PLA 2 2 e a concentração de antioxidantes lipossolúveis se associam com os principais marcadores de risco cardiovascular em adolescentes. Métodos: Duzentos e quarenta e dois adolescentes (10 a 19 anos), de ambos os sexos foram distribuídos, segundo o índice de massa corporal (IMC), em três grupos: Eutróficos (n=77), Sobrepeso (n=82) e Obesos (n=83). A amostra foi caracterizada através de parâmetros sócio-econômicos, estado de saúde, uso de medicamentos, antedecentes familiares de doenças crônicas e prática de atividade física. Foram avaliados ainda os dados antropométricos (peso, altura e composição corporal - bioimpedância), e o consumo alimentar por meio de três recordatórios 24 h. A partir de uma amostra de sangue coletada após jejum (12h), realizaram-se as análises da atividade da Lp-PLA , LDL(-) e seus auto-anticorpos, perfil lipídico (colesterol total, LDL-C, HDL-C e triglicerídeos), tamanho da HDL, proteína transportadora de éster de colesterol (CETP), ácidos graxos não esterificados (NEFAs), adipocitocinas, assim como antioxidantes (retinol, licopeno, -tocoferol e -caroteno) no plasma. Resultados: Artigo 1: Lp-PLA maybe an important cardiovascular biomarker in obese adolescents. Verificou-se que o perfil lipídico, insulina, HOMA-IR (resistência à insulina) e LDL(-) evidenciaram um maior risco cardiovascular nos adolescentes obesos. A atividade da enzima Lp-PLA 2 mostrou uma variação proporcional ao IMC, circunferência da cintura e porcentagem de gordura.


Subject(s)
Humans , Male , Female , Child , Adolescent , Adult , Phospholipases A/physiology , Phospholipases A/blood , Lipoproteins/physiology , Biomarkers/blood , Obesity , Adolescent Health , Anthropometry , Body Mass Index , Child Welfare , Risk Factors
6.
Arch. Clin. Psychiatry (Impr.) ; 37(2): 73-80, 2010. tab
Article in Portuguese | LILACS | ID: lil-550605

ABSTRACT

CONTEXTO: Com a descoberta de que a neurogênese constitutiva persiste no cérebro adulto, surgiu a hipótese na literatura de que a doença de Alzheimer (DA) poderia ser superada, ou pelo menos melhorada, visto que a geração de novos neurônios poderia ajudar a compensar a perda de neurônios na doença. OBJETIVOS: Neste trabalho, foi revisada a literatura sobre a neurogênese endógena no cérebro de sujeitos com DA e modelos animais de DA, os efeitos de atividade cognitiva sobre a neurogênese, e a relação entre a enzima fosfolipase A2 (PLA2) e a neurogênese. MÉTODOS: A base de dados MedLine foi pesquisada utilizando as palavras-chave doença de Alzheimer, atividade cognitiva, fosfolipase A2, neurogênese e neuritogênese. RESULTADOS: A revisão da literatura evidenciou neuroproliferação aumentada no cérebro com DA, no entanto, os novos neurônios falham em se diferenciar em neurônios maduros. Uma estratégia não farmacológica, ambiente enriquecido, aumenta a neurogênese (incluindo amadurecimento neuronal) em animais experimentais. Relação entre PLA2 e neurogênese tem sido demonstrada em modelos experimentais in vitro e in vivo. CONCLUSÃO: Os dados indicam que o enriquecimento ambiental (com estimulações cognitiva e física) poderia ser uma estratégia apropriada para promover a neurogênese endógena na DA e sugerem a participação da PLA2 na neurogênese promovida por estimulação cognitiva.


BACKGROUND: With the discovery that constitutive neurogenesis persists in the adult brain, has emerged the hypothesis in the literature that Alzheimer disease (AD) could be overcome, or at least ameliorated, since the generation of new neurons might help to compensate for the loss of neurons in the disease. OBJECTIVES: In this work the literature on endogenous neurogenesis in the brain of subjects with AD and animal models of AD, the effects of cognitive activity on neurogenesis, and the relationship between the enzyme phospholipase A2 (PLA2) and neurogenesis was reviewed. METHODS: MedLine database was searched using the keywords Alzheimer disease, cognitive activity, phospholipase A2, neurogenesis, and neuritogenesis. RESULTS: The literature review evidenced increased neuroproliferation in AD brain, however, the new neurons fail to differentiate into mature neurons. A non-pharmacological strategy, enriched environment, increases neurogenesis (including neuronal maturation) in experimental animals. Relationship between PLA2 and neurogenesis has been demonstrated in in vitro and in vivo experimental models. DISCUSSION: The data indicate that environmental enrichment (with cognitive and physical stimulations) might be a suitable strategy to promote endogenous neurogenesis in AD, and suggest the participation of PLA2 in the neurogenesis promoted by cognitive stimulation.


Subject(s)
Higher Nervous Activity , Cognition , Alzheimer Disease/diagnosis , Phospholipases A/analysis
7.
Bulletin of the National Research Centre. 2008; 33 (2): 181-191
in English | IMEMR | ID: emr-86076

ABSTRACT

Despite of the fact that functionally diverse phospholipase A2 variants of snake venoms are well characterized at the level of protein and gene sequences; the patterns of individual snake venom PLA2s are poorly known. We investigated the activity, molecular weights and isoelectric points of the phospholipase A2s of some medically important snake venoms in Egypt. Portrayal of the phospholipase A2 activity of the vipers, "Pseudocerastes persicus fieldi, Cerastes cerastes and Echis carinatus" and the elapids "Naja haje, Walterinnesia aegyptia and Naja nigricollis" venoms revealed that: 1- The elapid venoms, with the exception of Naja haje, displayed higher PLA2 activity than viper venoms; 2- The molecular weights of the phospholipase A2 variants were close to 14 kDa; 3- The major phospholipase A2s of Naja nigricollis were basic proteins while those of Walterinnesia aegyptia venom were acidic proteins; 4- The Naja nigricollis and Pseudocerastes persicus fieldi venoms possessed the highest phospholipase A2 activity while the Walterinnesia aegyptia and Pseudocerastes persicu fieldi had the highest hemolytic activity of the tested elapids and vipers, respectively; 5- The in vitro hemolytic activities of the venoms were inhibited by the heterologous antivenoms, suggesting that the venom hemolytic factor [s] have shared epitopes. The data provided biochemical information of snake venoms phospholipase A2 which allowed designing procedure for isolation of the phospholipase A2s to study their pharmacological effects


Subject(s)
Animals , Phospholipases A/pharmacology , Molecular Weight , Isoelectric Point , Viperidae , Elapidae
8.
Braz. j. morphol. sci ; 24(1): 55-58, jan.-mar. 2007. ilus
Article in English | LILACS | ID: lil-497607

ABSTRACT

Agkistrodon contortrix laticinctus myotoxin (ACLMT) is a myotoxic Lys49 phospholipase A2 isolated from the venom of the broad-banded copperhead, A. c. laticinctus. We have previously shown that ACLMT affects water transport in toad bladders, but little in known about the mechanisms involved in the action of this toxin on membrane permeability. In this study, we examined the morphological alterations caused by ACLMT in toad bladder epithelium. The bladders were exposed to the toxin (20 nM) for 30 min at 23o C using Bentley’s technique. Longitudinal and cross sections were obtained from paraffin-embedded bladders and stained with hematoxylin-eosin prior to analysis by light microscopy. Exposure to the toxin resulted in disorganization of the epithelial cell layer and damage to the smooth muscle bundles. The smooth muscle cells were swollen, with hypercontracted myofi laments and clear areas among the fibers. These findings suggest that ACLMT affects the structural integrity of the epithelium, and that the pathological changes induced by this toxin in smooth muscle cells may be caused by an increase in the cytosolic calcium concentration. These results contribute to our understanding of the mechanisms involved in the action of snake venom Lys49 PLA2 myotoxins in biological tissues.


Subject(s)
Animals , Agkistrodon , Crotalid Venoms , Epithelial Cells , Myocytes, Smooth Muscle , Phospholipases A , Urinary Bladder , Anura , Epithelium
9.
J. venom. anim. toxins incl. trop. dis ; 13(1): 103-121, 2007. graf, tab
Article in English | LILACS | ID: lil-444615

ABSTRACT

Two presynaptic phospholipases A2 (PLA2), neuwieditoxin-I (NeuTX-I) and neuwieditoxin-II (NeuTX-II), were isolated from the venom of Bothrops neuwiedi pauloensis (BNP). The venom was fractionated using molecular exclusion HPLC (Protein-Pak 300SW column), followed by reverse phase HPLC (æBondapak C18 column). Tricine-SDS-PAGE in the presence or absence of dithiothreitol showed that NeuTX-I and NeuTX-II had a molecular mass of approximately 14 kDa and 28kDa, respectively. At 10æg/ml, both toxins produced complete neuromuscular blockade in indirectly stimulated chick biventer cervicis isolated preparation without inhibiting the response to acetylcholine, but NeuTX-II reduced the response to KCl by 67.0±8.0 percent (n=3; p<0.05). NeuTX-I and NeuTX-II are probably responsible for the presynaptic neurotoxicity of BNP venom in vitro. In fact, using loose patch clamp technique for mouse phrenic nerve-diaphragm preparation, NeuTX-I produced a calcium-dependent blockade of acetylcholine release and caused appearance of giant miniature end-plate potentials (mepps), indicating a pure presynaptic action. The N-terminal sequence of NeuTX-I was DLVQFGQMILKVAGRSLPKSYGAYGCYCGWGGRGK (71 percent homology with bothropstoxin-II and 54 percent homology with caudoxin) and that of NeuTX-II was SLFEFAKMILEETKRLPFPYYGAYGCYCGWGGQGQPKDAT (92 percent homology with Basp-III and 62 percent homology with crotoxin PLA2). The fact that NeuTX-I has Q-4 (Gln-4) and both toxins have F-5 (Phe-5) and Y-28 (Tyr-28) strongly suggests that NeuTX-I and NeuTX-II are Asp49 PLA2.


Subject(s)
Animals , Bothrops/metabolism , Crotalid Venoms , Phospholipases A/chemistry , Neurotoxins/poisoning
10.
Indian J Biochem Biophys ; 2006 Jun; 43(3): 154-9
Article in English | IMSEAR | ID: sea-27042

ABSTRACT

Phospholipase A2s (PLA2) are a class of enzymes, which catalyze the hydrolysis of membrane phospholipids at the sn-2 position to release fatty acids and lysophospholipids. When the fatty acid is arachidonic acid (AA), a complementary metabolism leads to pro-inflammatory mediators collectively known as eicosanoids. Thus, inhibiting PLA2 activity remains a prime target for the development of new drugs for the treatment of inflammation-related diseases. More than one type of PLA2s plays a major role in inflammatory disease conditions. In the present study, quantitative structure-activity relationship (QSAR) study was performed for a series of 48 Me-indoxam derivatives as human group V PLA, (hVPLA2) inhibitors, using molecular operating environment (MOE) software. The hVPLA2 is a secretory PLA2 (sPLA2), involved in eicosanoid formation in inflammatory cells such as macrophages and mast cells. These studies have come out with three good predictive models (r = 0.82-0.84), which are cross-validated (rcv = 0.68-0.70) by leave-out-one method (Loo). The positive correlation of spatial descriptor Pmiz with inhibitory activity shows that proper orientation of the substitution at R position towards Z-axis is necessary to facilitate the possible interactions of the indole core with active site residues of the PLA2 enzyme. The negative contribution of b_rotN (atom and bond count-type descriptor) suggests that increasing flexibility conferred by the R substitution is detrimental for the activity. In addition to the hVPLA2 inhibitory activity is found to be highly influenced by molecular size, energy and polarity of the Me-indoxam derivatives.


Subject(s)
Catalytic Domain , Drug Design , Enzyme Inhibitors/chemistry , Group V Phospholipases A2 , Humans , Indoles/chemistry , Models, Chemical , Phospholipases A/antagonists & inhibitors , Phospholipases A2 , Quantitative Structure-Activity Relationship
12.
Article in Chinese | WPRIM | ID: wpr-813724

ABSTRACT

OBJECTIVE@#To observe the effect of chloroquine on the apoptosis of intestinal mucosa epithelial cell and enterogenous bacteria-endotoxin translocation after total hepatic ischemia-reperfusion in rats.@*METHODS@#The rat total hepatic ischemia-reperfusion model was built by blocking the hepatic portal, suprahepatic and infrahepatic vena cava for 20 minutes. Ninety Sprague-Dawley rats were assigned randomly into the sham operation group (Group A, n = 30), total hepatic ischemia-reperfusion treatment group (Group B, n = 30), and chloroquine administrated group (Group C, n = 30). Each group was subdivided randomly into 3 subgroups (n = 10) according to different experiment time phases as follows: after 20 minutes of total hepatic vascular exclusion (T0), 4 hours after reperfusion (T1), and the 48 hours of survival. Group A and Group B were intravenously injected with normal saline 1 mL/kg while Group C received chloroquine 10 mg/kg which dissolved in 1 mL/kg normal saline intravenously. The levels of portal blood D-lactate, TNF-alpha, endotoxin, and the intestinal mucosa MDA concentration were measured at T0 and T1; the portal blood, mesenteric lymph node, and spleen tissues were cultured for bacteria; and the apoptotic index of intestinal mucosa epithelial cells at T0 and T1 and the survival rate after 48 hour reperfusion were obtained.@*RESULTS@#Compared with Group A, the levels of portal blood D-lactate, TNF-alpha, endotoxin and the intestinal mucosa MDA in Group B and Group C were significantly higher (P < 0.05 or P < 0.01). These indexes of Group C were lower than those of Group B (P < 0.05). The portal vein blood, mesenteric lymph node and spleen tissues existed the bacterium translocation both in Group B and Group C, and the positive rate in Group C was lower than that in Group B (P < 0.05). Apoptotic index of the intestinal mucosa epithelial cell increased significantly in Group B (P < 0.01) and Group C (P < 0.05), but the apoptotic index in Group C was lower than that in Group B (P < 0.05); the 48 hour survival rate of the rats in Group C was higher than that in group B (P < 0.05).@*CONCLUSION@#Chloroquine may decrease the intestinal mucosa epithelial cell apoptosis and the enterogenous bacteria-endotoxin translocation after total hepatic ischemia-reperfusion and increase the survival rate of the rats.


Subject(s)
Animals , Female , Male , Rats , Bacterial Translocation , Chloroquine , Pharmacology , Epithelial Cells , Pathology , Escherichia coli , Physiology , Intestinal Mucosa , Pathology , Intestine, Small , Microbiology , Pathology , Liver , Phospholipases A , Random Allocation , Rats, Sprague-Dawley , Reperfusion Injury , Microbiology , Pathology
13.
São Paulo; s.n; 2006. [120] p.
Thesis in Portuguese | LILACS | ID: lil-587130

ABSTRACT

A Doença de Alzheimer (DA) é uma desordem neurodegenerativa progressiva que causa comprometimento cognitivo em idosos. O diagnóstico clínico da DA é complexo. Existe uma grande necessidade de técnicas capazes de detectar a doença nos estágios iniciais, tanto para auxiliar o diagnóstico quanto para monitorar a efetividade dos tratamentos disponíveis. As alterações bioquímicas da DA são resultado de processos celulares como o metabolismo da proteína precursora do amilóide (APP), fosforilação da tau, stress oxidativo, inflamação e desregulação lipídica. Até o momento não existem marcadores bioquímicos para auxiliar o diagnóstico da DA. Este trabalho avaliou três possíveis candidatos a marcadores bioquímicos para a DA. Foram investigados a razão da APP (rAPP) de 130/110 kDa, fluidez de membrana e atividade da fosfolipase A2 em plaquetas de pacientes com DA e Comprometimento Cognitivo Leve (CCL), comparando-se seus resultados com controles idosos saudáveis. A fluidez das membranas das plaquetas foi avaliada por meio da anisotropia com a sonda fluorescente DPH (Difenilhexatrieno); a comparação das razões da APP foi realizada por Western Blotting empregando o anticorpo 22C11 e a da atividade da PLA2 foi determinada por ensaio radioenzimático com substratos e concentrações de cálcio específicas para cada um dos três principais grupos da enzima. A rAPP, as atividades da sPLA2 e iPLA2 estavam significantemente reduzidas na DA quando comparadas com controles, enquanto que a cPLA2 e a fluidez de membrana não apresentaram diferenças entre os grupos. A rAPP e a iPLA2 também apresentaram diferenças significativas entre CCL e DA, além de estarem correlacionadas com os parâmetros cognitivos MEEM e CAMCOG. A rAPP também estava correlacionada com a anistropia do DPH.


Alzheimer disease (AD) is a progressive neurodegenerative disorder that causes cognitive impairment in the elderly. The clinical diagnosis of AD is complex. Thus, there is a great need for sensitive techniques to detect neurodegeneration in the early stages to asset in the diagnosis and to follow the effectiveness of therapy. The biochemical alterations in the AD brain result from cellular processes such as amyloid precursor protein (APP) metabolism, tau phosphorylation, oxidative stress, inflammation and lipid dysregulation. So far there are no biochemical markers to help the AD diagnosis. The purpose of this study was to evaluate three possible candidates to biochemical marker of AD. The APP 130/110 kDa ratio, membrane fluidity and phospholipase A2 activity in platelets of patients with AD and mild cognitive impairment (MCI) were investigated compared to their results with healthy elderly controls. The membrane fluidity of platelets was assessed by the fluorescence anisotropy of DPH (diphenyl-hexatriene); the levels of APP isoforms were evaluated by Western Blot analysis using 22C11 antibody and the PLA2 activity was measured by radio-enzymatic assay with enzyme specific substrate and calcium concentrations for each one of the three main groups of the enzyme. The APP ratio (APPr), the sPLA2 and iPLA2 activity were markedly decreased in AD in comparing with controls, whereas a cPLA2 and membrane fluidity didn't show any alteration between the groups evaluated. The APPr and iPLA2 also showed significant differences between MCI e AD, and were correlated with cognitive parameters MMSE and CAMCOG. The APPr was also correlated with DPH anisotropy.


Subject(s)
Humans , Male , Female , Adult , Middle Aged , Aged , Alzheimer Disease , Blood Platelets , Cognition Disorders , Membrane Fluidity , Biomarkers , Phospholipases A
14.
Fortaleza; s.n; 2006.
Thesis in Portuguese | LILACS | ID: lil-743341

ABSTRACT

A insuficiência renal aguda é uma das complicações mais frequentes nos envenenamentos ofídicos. Contudo, a sua patogênese permanece obscura. Em nossos estudos foram avaliados os efeitos renais causados pelas miotoxinas purificadas dos venenos das serpentes Bothrops jararacussu (Bthtx I, Lys 49 e Bthtx II, Asp 49) e Bothrops moojeni (BmTx I, Lys 49), assim como pelas lectinas dos venenos de Bothrops moojeni (BmLec) e Bothrops jararacussu (BJcuL). Tentando avaliar o mecanismo envolvido nos efeitos renais das substâncias acima mencionadas, foram testados os efeitos da indometacina, um bloqueador inespecífico de ciclooxigenase. Adicionalmente, foram avaliados os efeitos inibitórios do Tezosentan, um bloqueador de receptor de endotelina, nos efeitos renais causados pelo miotoxina I da serpente Bothrops moojeni. Para tanto, as miotoxinas, na dosagem de 5μg/mL, ou as lectinas, na dosagem de 10μg/mL foram adicionadas 30 minutos depois do início dos experimentos. Contudo, a indometacina e o tezosentan foram adicionados no sistema de perfusão sempre no início de cada experimento na dosagem de 10μg/mL. Os efeitos renais foram comparados com um grupo controle, onde os rins foram perfundidos somente com a solução de Krebs-Henseleit modificada. Bthtx I, Bthtx II e BmLec aumentaram a pressão de perfusão (C120 = 110,28 +- 3,09, Bthtx I120 = 171,20 +- 6,3*, Bthtx II120 = 175,50 +- 7,20* e BmLec120 = 152,50 +- 2,10*), a resit~encia vascular renal (C120 = 5,46 +- 0,54, Bthtx I120 = 8,62 +- 0,37*, Bthtx II120 = 8,90 +- 0,36* e BmLec120 = 7,77 +- 0,30*), o fluxo urinário (C120 = 0,143 +- 0,008, Bthtx I120 = 0,326 +- 0,048*, Bthtx II120 = 0,373 +- 0,085* e BmLec120 = 0,085 +- 0,007*), o ritmo de filtração glomerular (C120 = 0,678 +- 0,065, Bthtx I120 = 0,855 +- 0,133*, Bthtx II120 = 1,224 +- 0,282* e BmLec120 = 1,037 +- 0,055*) e a excreção de sódio potássio e cloreto (ENa+, EK+, ECl-)...


Subject(s)
Bothrops , Lectins, C-Type , Phospholipases A
15.
Arch. venez. farmacol. ter ; 25(1): 6-10, 2006. ilus, tab
Article in Spanish | LILACS | ID: lil-517128

ABSTRACT

El veneno de Apis mellífera es una mezcla compleja de compuestos por moléculas de alto y bajo peso molecular, enzimas y peptidos, de los cuales la fosfolipasa A2, melitina y apamina son los compuestos causantes de los accidentes fatales en el ser humano y mamíferos. Provocando además, daño local en el sitio de picadura y otos efectos graves, tales como reacciones sistémicas. La toxicidad del veneno de abeja, sobre los humanos, no se conoce con exactitud, la dosis letal 50 en ratones, del veneno liofilizado y purificado es de 2.5 a 2.8 mg/kg por vía endovenosa y la dosis letal es de 6 mg/kg por vía endovenosa. Cuando una abeja pica, inyecta de 50 a 100 µg de veneno. Los efectos tóxicos de la picadura son provocados inmediatamente, el inicio de la anaflaxis es típico y rápido, desencadenado minutos después de la picadura. La enfermedad del suero puede ocurrir 10 a 14 días después del accidente. Cien picaduras pueden ser necesarias para matar a un humano, auqnue hay otros casos donde una picadura puede provocar la muerte y otras que han picado 400 ó más y han sobrevivido.


Subject(s)
Apamin , Bee Venoms , Melitten , Phospholipases A , Toxicology
16.
Medicina (B.Aires) ; 66(6): 512-516, 2006. graf, ilus
Article in English | LILACS | ID: lil-453018

ABSTRACT

Crotalus durissus terrificus (C.d.t.) (South American rattlesnake) venom possesses myotoxic and neurotoxic activities, both of which are also expressed by crotoxin, the principal toxin of this venom. Crotoxin contains a basic phospholipase A2 (PLA2) and a non toxic acidic protein, crotapotin. We have produced and investigated the ability of IgG antibodies raised in rabbits against PLA2 to neutralize the lethality of the whole venom. PLA2 was isolated by gel filtration chromatography (Sephadex G-75). Specific antibodies were obtained by subcutaneous and intramuscular inoculation of PLA2 (700 µg) with Freund adjuvant. Groups of six mice (20 + 2 g) were inoculated with 0.5 ml i.p. of C. d. t. venom (4 µg) or a mixture of venom that had been preincubated with the desired volume of IgG antibodies. Mortality, recorded 24 and 48 h after inoculation, showed that IgG anti-PLA2 were more effective than anticrotalic serum in neutralizing the lethal activity. These results demonstrate that it could be possible to obtain an anti-venom made by specific antibodies with a high level of protection against the lethal component of C.d.t. venom, and/or the inclusion of these antibodies as a supplement in heterologous anti-venoms


El veneno de Crotalus durissus terrificus (C.d.t.) (Cascabel de Sud América) posee actividad miotóxica y neurotóxica, actividades que también exhibe el complejo crotoxina, principal componente tóxico de este veneno. El complejo crotoxina está constituido por una fosfolipasa A2 básica (PLA2) y una proteína acídica no tóxica, el crotapotín. En este trabajo se estudió la capacidad neutralizante de anticuerpos IgG anti-PLA2 sobre la letalidad inducida por el veneno entero. El antígeno PLA2, fue aislado por cromatografía de filtración en gel (Sephadex G-75). Se inocularon conejos machos por vía subcutánea e intramuscular, con 700 µg de PLA2 y adyuvante para la obtención de anticuerpos específicos. La capacidad neutralizante del antisuero se analizó en ratones por inoculación con diluciones de veneno entero preincubado con un volumen adecuado de anticuerpos IgG anti-PLA2. Se inocularon ratones controles con 0.5 ml i.p. de veneno (4 µg.ml-1). El número de muertes fue contabilizado a las 24 y 48 h posteriores a la inoculación, demostrándose que la capacidad neutralizante de los anticuerpos IgG anti-PLA2 fue superior a la obtenida con el antiveneno crotálico. Los resultados obtenidos demuestran la potencial aplicación de antivenenos constituidos por anticuerpos específicos contra PLA2, y/o la inclusión de estos anticuerpos como suplementos en antivenenos polivalentes


Subject(s)
Animals , Male , Mice , Rabbits , Antivenins/immunology , Crotalus/immunology , Crotoxin/immunology , Immunoglobulin G/immunology , Neutralization Tests/methods , Phospholipases A/immunology , Antibody Specificity , Antivenins/biosynthesis , Antivenins/pharmacology , Buffers , Chromatography, Agarose , Crotoxin/toxicity , Disease Models, Animal , Enzyme-Linked Immunosorbent Assay , Hemolysis/immunology , Immunoblotting , Immunoelectrophoresis , Immunoglobulin G/biosynthesis , Immunoglobulin G/pharmacology , Neuromuscular Blockade , Phospholipases A/isolation & purification , Phospholipases A/toxicity
17.
Chinese Journal of Cardiology ; (12): 812-815, 2006.
Article in Chinese | WPRIM | ID: wpr-238512

ABSTRACT

<p><b>OBJECTIVE</b>To measure the serum level of secretory type II phospholipase A2 (sPLA2) in patients with coronary heart disease and investigate the possible relationship with IL-8 and LPA.</p><p><b>METHODS</b>A total of 110 patients with acute coronary syndrome (ACS), 63 patients with stable coronary heart disease (SCHD) group and 89 non-CHD control patients were studied. Serum levels of sPLA2, IL-8, LPA and hs-CRP were measured and the correlation among these parameters was observed.</p><p><b>RESULTS</b>The levels of serum sPLA2 [(68 +/- 17) U/ml], IL-8 [(182 +/- 80) pg/ml] and LPA [(2.85 +/- 0.36) micromol/L] were significantly higher in CHD patients than those in controls [sPLA2: (55 +/- 12) U/ml; IL-8: (119 +/- 33) pg/ml; LPA: (2.34 +/- 0.36) micromol/L, all P < 0.01], and sPLA2 and IL-8 were also significantly higher in ACS patients [sPLA2: (71 +/- 18) U/ml; IL-8: (195 +/- 78) pg/ml] than those in SCHD patients [sPLA2: (63 +/- 12) U/ml; IL-8: (159 +/- 79) pg/ml, both P < 0.01]. Serum sPLA2 level was positively correlated with hs-CRP, IL-8 and LPA (r = 0.203, P = 0.007; r = 0.658, P < 0.01; r = 0.231, P = 0.005, respectively). The relative risk of having CHD is 6.248 (P < 0.01) with the sPLA2 level above 63.75 U/ml.</p><p><b>CONCLUSION</b>Elevated serum sPLA2 level is a risk factor for CHD.</p>


Subject(s)
Adult , Aged , Aged, 80 and over , Female , Humans , Male , Middle Aged , C-Reactive Protein , Metabolism , Coronary Angiography , Coronary Disease , Blood , Diagnostic Imaging , Group II Phospholipases A2 , Interleukin-8 , Blood , Lysophospholipids , Blood , Phospholipases A , Blood , Phospholipases A2
18.
Article in Chinese | WPRIM | ID: wpr-234192

ABSTRACT

<p><b>OBJECTIVE</b>To isolate and purify a new phospholipase A2 (PLA2) homologue from Agkistrodon blomhoffii siniticus and investigate its effects on the gene expression profile of Hep3B cells.</p><p><b>METHODS</b>The PLA2 homologue was isolated and purified by reverse-phase high-performance liquid chromatography (HPLC) and its purity was determined also by HPLC. The relative molecular mass of the homologue was measured by electrospray ionization mass spectrum. The gene expression profile of Hep3B cells was detected with gene chip after exposure of the cells to 139 microg/ml PLA2 homologue for 12 h.</p><p><b>RESULTS</b>The purity of the PLA2 homologue was 97.2%, whose relative molecular mass was 13,900. After exposure of Hep3B cells to 139 microg/ml PLA2 homologue for 12 h, 19 genes were down-regulated and 20 up-regulated in the cells. The genes showing altered expressions in response to the exposure were mainly involved in cell cycle control and DNA damage repair, cell apoptosis and senescence, production of signal transduction molecules and transcription factors, cell adhesion, angiogenesis, and tumor invasion and metastasis.</p><p><b>CONCLUSIONS</b>The PLA2 homologue induces alterations in the expression of a wide variety of genes involved in the growth and metastasis of tumor cells. The results of this study provide clues for further study of the possible mechanism for the action of PLA2 homologue on Hep3B cells.</p>


Subject(s)
Animals , Agkistrodon , Carcinoma, Hepatocellular , Genetics , Chromatography, High Pressure Liquid , DNA Damage , Gene Expression Profiling , Gene Expression Regulation, Neoplastic , Hyaluronan Receptors , Genetics , Isoenzymes , Liver Neoplasms , Genetics , Phospholipases A , Pharmacology , Phospholipases A2 , Proto-Oncogene Proteins c-bcr , Genetics , Snake Venoms , Tumor Cells, Cultured
19.
Biosci. j ; 21(2): 95-103, May-Aug. 2005. tab, graf
Article in Portuguese | LILACS | ID: lil-430571

ABSTRACT

O objetivo do presente trabalho foi estudar a ação do extrato aquoso de C. grandiflora (EA) sobre as atividades PLA2 miotóxica e letal das peçonhas (P) de B. moojeni e B. neuwiedi e sua toxicidade aguda. O EA (1:160; P:EA, m/m) inibiu em 74,5 por cento e 57,5 por cento a atividade PLA2 das peçonhas e, em 51 por cento, a atividade CK do plasma de camundongos induzida pela peçonha de B. moojeni na proporção de 1:4 (P:EA, m/m). Houve um aumento da sobrevivência (83 por cento) dos camundongos que receberam EA preparado com folhas coletadas em novembro (1:26; m/m), resultado não encontrado com o EA preparado a partir de folhas coletadas em junho. A efeitos colaterais do EA de C. grandiflora foram ptose palpebral, letargia e piloereção e, apnéia, paralisia flácida e óbito (100 por cento), respectivamente para as doses de 250 e 500 mg. Kg-1. Estes resultados indicam que o EA é uma fonte de compostos capazes de neutralizar alguns efeitos tóxicos de peçonhas botrópicas, porém, investigações adicionais são necessárias para eliminar ou minimizar seus efeitos colaterais.


Subject(s)
Toxicity Tests, Acute , Casearia , Phospholipases A , Snakes , Venoms
20.
Iatreia ; 18(1): 217-227, mar. 2005. ilus
Article in Spanish | LILACS | ID: lil-406198

ABSTRACT

El veneno de abejas incluye compuestos orgánicos de bajo y alto peso molecular. Se encuentran en él péptidos simples como la apamina, polipéptidos como la melitina y enzimas como la fosfolipasa A2 y la hialuronidasa; recientemente se demostró que algunos citratos son también componentes mayores del veneno. La melitina y la fosfolipasa A2 son los componentes principales y más abundantes, cerca del 75 por ciento, en una relación 3:1. La melitina se adhiere a las membranas de los glóbulos rojos, produciendo hemólisis; la fosfolipasa A2, el mayor de los alergenos del veneno, actúa como agente bloqueador que puede provocar parálisis respiratoria. La apamina representa cerca del 2 por ciento del veneno total; es menos tóxica que los compuestos anteriores y se comporta como neurotoxina de acción motora; además de desencadenar un efecto cardioestimulante parecido al de las drogas adrenérgicas, tiene propiedades antiarrítmicas. Un 2 por ciento del veneno lo constituye el péptido MCD (Mast Cell Degranulation) o factor degranulador de los mastocitos, uno de los compuestos responsables de la liberación de histamina y serotonina. Adicionalmente, se han identificado compuestos como fosfatasa ácida, norepinefrina, dopamina e histamina. En esta revisión se exponen aspectos relacionados con la conformación y función del aparato picador, con la composición y acción del veneno, con el comportamiento y los hábitos de las abejas y, finalmente, con las medidas de manejo y tratamiento de sus picaduras; se procuró hacer una mirada comparativa de esos aspectos aplicados a las abejas europeas y a las africanizadas


Bee venom includes organic components of low and high molecular weight such as simple peptides like apamin, polypeptides like mellitin and enzymes like phospholipase A2 and hyaluronidase. It was recently demonstrated that some citrates are also important components of this venom. Mellitin and phospholipase A2 are the main and more abundant components, around 75%, in a ratio of 3:1; mellitin interacts with human red blood cells membranes producing hemolysis; and phospholipase A2, the main allergen of the venom, may act as blocking agent causing respiratory paralysis. Apamin represents about 2% of the total venom; it is less toxic than the aforementioned substances and acts as a motor neurotoxin; it is also responsible for triggering a cardiostimulant effect similar to that of adrenergic drugs; it has antiarrhythmic properties as well. Peptide MCD (Mast Cell Degranulation factor) constitutes 2% of the venom, and it is one of the components responsible for histamine and serotonin release. Additionally, other components have been identified such as acid phosphatase, norepinephrine, dopamine and histamine. This review discusses aspects of the conformation and function of the bee stinging apparatus, of venom composition and action and ofs the behavior and habits of these insects. Finally, handling and treatment of bees bites are discussed. Applied aspects of the European and Africanized bees are compared


Subject(s)
Apamin , Phospholipases A , Bees , Bites and Stings , Hyaluronoglucosaminidase , Anaphylaxis , Melitten , Neurotoxins , Peptides
SELECTION OF CITATIONS
SEARCH DETAIL