The PBII gene of the human salivary proline-rich protein P-B produces another protein, Q504X8, with an opiorphin homolog, QRGPR.

OBJECTIVES: The NCBI gene database and human-transcriptome database for alternative splicing were used to determine the expression of mRNAs for P-B (SMR3B) and variant form of P-B. The translational product from the former mRNA was identified as the protein named P-B, whereas that from the latter has not yet been elucidated. In the present study, we investigated the expression of P-B and its variant form at the protein level. DESIGN: To identify the variant protein of P-B, (1) cationic proteins with a higher isoelectric point in human pooled whole saliva were purified by a two dimensional liquid chromatography; (2) the peptide fragments generated from the in-solution of all proteins digested with trypsin separated and analyzed by MALDI-TOF-MS; and (3) the presence or absence of P-B in individual saliva was examined by 15% SDS-PAGE. RESULTS: The peptide sequences (I37PPPYSCTPNMNNCSR52, C53HHHHKRHHYPCNYCFCYPK72, R59HHYPCNYCFCYPK72 and H60HYPCNYCFCYPK72) present in the variant protein of P-B were identified. The peptide sequence (G6PYPPGPLAPPQPFGPGFVPPPPPPPYGPGR36) in P-B (or the variant) and sequence (I37PPPPPAPYGPGIFPPPPPQP57) in P-B were identified. The sum of the sequences identified indicated a 91.23% sequence identity for P-B and 79.76% for the variant. There were cases in which P-B existed in individual saliva, but there were cases in which it did not exist in individual saliva. CONCLUSIONS: The variant protein is produced by excising a non-canonical intron (CC-AC pair) from the 3'-noncoding sequence of the PBII gene. Both P-B and the variant are subject to proteolysis in the oral cavity.

Identification of cysteine proteases and screening of cysteine protease inhibitors in biological samples by a two-dimensional gel system of zymography and reverse zymography.

We have developed a two-dimensional (2D-) gel system of zymography and reverse zymography for the detection and characterization of proteases and protease inhibitors. Isoelectric focusing (IEF) agarose gels with pH gradients were employed for separation in the first-dimension and sodium dodecyl sulfate (SDS)-polyacrylamide gel copolymerized with gelatin used for the second dimension. Proteases and protease inhibitors separated by IEF gel were applied on the second gel without trichloroacetic acid (TCA) fixation. Protease activity in the 2D-gel was visualized as transparent spots where gelatin substrate was digested after commassie brilliant blue (CBB) staining. Some of the transparent spots from the skin mucus extract of rainbow trout were determined to be a cysteine protease through use of E-64 or CA-074. In the reverse zymography technique, the gel was incubated with papain solution at 37 degrees C for 18 h. Cysteine protease inhibitors from broad bean seeds were detected as clear blue spots after CBB staining. The amino (N-) terminal sequences of four papain inhibitor spots thus detected were demonstrated to be identical to that of favin beta chain, a broad bean lectin. Taken together, our system can be considered to be an efficient technique for discovering and characterizing new proteases and protease inhibitors in biological samples. This is the first report describing a 2D-gel system of zymography and reverse zymography.

Evidence for inclusion of a segment of Escherichia coli genomic DNA in bovine tooth germ mRNA encoding salivary proline-rich protein P-B.

In the course of cloning of bovine cDNA for proline-rich protein (PRP) P-B from bovine tooth germ cDNA, we found that one clone with 662 bp contained a 5'-terminal 393 bp (1-393 bp) sequence essentially identical to that of human P-B cDNA (154-546 in D29833) and bovine P-B cDNA (1-356 bp in AB192573) and a sequence of 233 bp (394-626 bp) highly homologous to the segment of E. coli K12 genomic DNA (365511-365744 in NC000913). Although the latter sequence is contained in the vector pT7Blue, which we used, our results show that this chimeric structure in bovine tooth germ P-B cDNA is not an artifact formed during the cloning process, but intrinsic to the bovine genome since the chimeric structure was detected in bovine tooth germ and bovine genomic DNA.

A novel cysteine protease inhibitor with lectin activity from the epidermis of the Japanese eel Anguilla japonica.

A novel cysteine protease inhibitor (Eel-CPI-1) was isolated from the epidermis of the eel. Eel-CPI-1 was shown to bind strongly to both lactose- and carboxymethylated papain-affinity gels. Its molecular mass under reducing condition was determined to be 18 kDa by SDS-polyacrylamide gel electrophoresis but approximately 30.5 kDa under non-reducing-conditions. Eel-CPI-1 inhibited papain (K(i)=18 nM) and ficin (K(i)=120 nM) competitively. Combined with the data on amino acid and sequence analysis, Eel-CPI-1 is identical to the eel lectin, AJL-2. This is the first report describing a cysteine protease inhibitor with lectin activity.

Tissue distribution and nucleotide sequence of bovine mRNA for salivary proline-rich protein P-B.

The tissue distribution of P-B was investigated to obtain information on the physiological significance of this proline-rich protein. To design primers and probes for a tissue distribution analysis, a polymerase chain reaction (PCR)-based cloning of bovine P-B cDNA was performed using tooth germ and the nucleotide sequence was determined. The cloned bovine P-B cDNA was composed of 356 bp and included the region corresponding to the mature P-B protein and part of the 3' non-coding sequence. This part of the sequence is identical to the corresponding region of human P-B cDNA from the submaxillary gland. DNA corresponding to the P-B mRNA was amplified by PCR using cDNAs from various bovine tissues including tooth germ, submaxillary gland, parotid gland, lachrymal gland, heart, liver, stomach, pancreas, spleen, kidney, adrenal, and ovary. A quantitative analysis indicated the heart, submaxillary gland, tooth germ and kidney to be major sites of P-B expression. The ubiquitous distribution of P-B mRNA among bovine tissues together with findings of the presence of genes hybridizable with a DNA probe for P-B among species such as human, bovine, rat, mouse, and yeast as reported previously suggested a fundamental physiological role for this protein.

Apoptosis induction by lectin isolated from the mushroom Boletopsis leucomelas in U937 cells.

A 15-kDa lectin was isolated from the edible mushroom Kurokawa by affinity chromatography using N,N'-diacetylchitobiose-Sepharose 4B. The results of microsequencing analysis indicated that the lectin has a partial amino acid sequence similar to the mushroom lectin, Agaricus bisporus agglutinin (ABA). We found that the Kurokawa lectin inhibited proliferation of human monoblastic leukemia U937 cells dose-dependently. Several lines of evidence indicated that this inhibition was due to its apoptosis induction. We observed that the lectin induced apoptotic bodies formation, chromatin condensation, and DNA ladder formation, features of apoptosis. The DNA ladder formation was inhibited by a general inhibitor of caspases, which are known to play essential roles in apoptosis. In contrast, ABA did not have cell growth-inhibiting or apoptosis-inducing activities. Thus, the Kurokawa lectin is the first mushroom lectin with apoptosis-inducing activity.

Sac I Restriction Fragment Length Polymorphism (RFLP) related to the human CST2 gene.

Restriction Fragment Length Polymorphism (RFLP) related to cystatin gene (CST) family was detected in the Japanese population by using restriction enzyme Sac I. A polymorphic site, located at 0.9 kb from the 3' end of the CST2 gene, revealed a two allele polymorphism with band sizes of 3.5 kb and 8.3 kb by hybridization with probe including exon 2 of the CST1 gene. The gene frequencies in the Japanese population were 0.326 for 3.5 kb allele and 0.674 for 8.3 kb allele (n = 86). The phenotypes of the polymorphism showed no association with the previously reported electrophoretic cystatin SA protein phenotypes.