Your browser doesn't support javascript.
loading
Mostrar: 20 | 50 | 100
Resultados 1 - 20 de 72
Filtrar
1.
Invertebr Syst ; 382024 Apr.
Artigo em Inglês | MEDLINE | ID: mdl-38744498

RESUMO

Scutigeromorph centipedes are conspicuous, yet often ignored myriapods for which little work has been conducted in southern South America. After examining recent and museum collections from Chile and Argentina, two new species of generic uncertainty were identified. A new genus of scutigerid centipede, Edgethreua , is therefore described with two new species, E. chilensis from Central Chile (type species of the genus) and E. goloboffi from Argentinian Patagonia. The new genus is characterised by the presence of scattered setiform bristles with short paired spines and the absence of simple spinulae and spines on all stomatotergites, the presence of a single spine-bristle in the prefemur of the second maxilla, a patch of cuticular ridges and pores surrounding the sensilla of the proximal labral portion of the epipharynx, the morphology of the sensilla of the distal patch of the hypopharynx and the morphology of the female gonopods. A phylogenetic analysis of the new species using two nuclear ribosomal RNA genes (18S and 28S rRNA), two mitochondrial ribosomal RNA genes (12S and 16S rRNA) and the mitochondrial protein-encoding gene cytochrome c oxidase subunit I show that the new genus does not cluster with any other described genus of scutigeromorph represented in molecular phylogenies. The data indicate that the new genus is probably sister group to a clade including the genera Lassophora , Ballonema and the subfamily Thereuoneminae, although one analysis suggests a position as sister group to Scutigerinae. ZooBank: urn:lsid:zoobank.org:pub:A4D453F3-9031-4E21-84C7-87F16C07AD51.


Assuntos
Quilópodes , Filogenia , Animais , Feminino , Masculino , Argentina , Chile , Quilópodes/genética
2.
J Nat Prod ; 87(4): 1103-1115, 2024 Apr 26.
Artigo em Inglês | MEDLINE | ID: mdl-38600744

RESUMO

Twelve new alkaloids, scolopenolines A-L (1-7, 9-11, 13, 14), along with six known analogues, were isolated from Scolopendra subspinipes mutilans, identified by analysis of spectroscopic data and quantum chemical and computational methods. Scolopenoline A (1), a unique guanidyl-containing C14 quinoline alkaloid, features a 6/6/5 ring backbone. Scolopenoline B (2) is a novel sulfonyl-containing heterodimer comprising quinoline and tyramine moieties. Scolopenoline G (7) presents a rare C12 quinoline skeleton with a 6/6/5 ring system. Alkaloids 1, 8, 10, and 15-18 display anti-inflammatory activity, while 10 and 16-18 also exhibit anti-renal-fibrosis activity. Drug affinity responsive target stability and RNA-interference assays show that Lamp2 might be a potentially important target protein of 16 for anti-renal-fibrosis activity.


Assuntos
Alcaloides , Animais Peçonhentos , Quilópodes , Animais , Alcaloides/farmacologia , Alcaloides/química , Alcaloides/isolamento & purificação , Estrutura Molecular , Artrópodes/química , Fibrose/tratamento farmacológico , Rim/efeitos dos fármacos , Quinolinas/farmacologia , Quinolinas/química , Anti-Inflamatórios/farmacologia , Anti-Inflamatórios/química , Humanos
3.
Zootaxa ; 5406(4): 588-600, 2024 Feb 08.
Artigo em Inglês | MEDLINE | ID: mdl-38480126

RESUMO

Based on the review of the original descriptions of Pachymerium antipai Cpue, 1968, P. atticum Verhoeff, 1901 and P. tabacarui Cpue, 1968 from Romania and the direct study of the external anatomy of P. ferrugineum (C. L. Koch, 1835) and Geophilus flavus (De Geer, 1778) from Romania, Egypt, Italy and Russia, P. antipai and P. aticum sensu Cpue (1968) are proposed as junior subjective synonyms of P. ferrugineum, while P. tabacarui is proposed as a junior subjective synonym of G. flavus. The presence of P. atticum in Romania is hereby considered doubtful. Revisions to the diagnosis of Pachymerium are proposed to help differentiate it from other geophilid genera. A discussion of the relative suitability of different morphological characters for distinguishing species within Pachymerium is also included.


Assuntos
Artrópodes , Quilópodes , Animais , Romênia
4.
Zootaxa ; 5415(2): 241-268, 2024 Feb 21.
Artigo em Inglês | MEDLINE | ID: mdl-38480205

RESUMO

Ninety new country records are recorded for 44 species of Anisoscelini Laporte, 1832 (Heteroptera: Coreidae: Coreinae). Informal distributional records are recognized and included, and updated distributions are provided for all accounted species. The following new synonymy is proposed: Malvana Stl, 1865 (= Belonomus Uhler, 1869, n. syn.) and Malvana serrulata Stl, 1865 (= Belonomus annulaticornis Uhler, 1869, n. syn.). The rank of one genus is reinstated: Bitta Osuna, 1984, stat. resurr. (formerly a subgenus of Anisoscelis Latreille, 1829). The following new or restored combinations are proposed: Bitta affinis (Westwood, 1840), comb. reins., Bitta alipes (Gurin-Mneville, 1833), comb. reins., Bitta gradadia (Distant, 1881), comb. reins., Bitta hymeniphera (Westwood, 1840), comb. reins., Bitta lurida (Brailovsky, 2016), comb. nov., and Bitta podalica Brailovsky & Mayorga, 1995, comb. reins.. We also present dichotomous keys to the twenty-nine genera of Anisoscelini, and to the species of the genera Anisoscelis Latreille, 1829 and Bitta Osuna, 1984.


Assuntos
Heterópteros , Animais , Quilópodes
5.
Zootaxa ; 5419(3): 401-418, 2024 Mar 07.
Artigo em Inglês | MEDLINE | ID: mdl-38480317

RESUMO

Schendyla antici sp. nov., a dwarf geophilomorph from the Mt. Medvednik (Western Serbia, Balkan Peninsula), is described and illustrated based on the specimens extracted from the soil samples. A detailed comparison with all species within the genus is provided. The new species has the lowest number of leg-bearing segments within the genus Schendyla Bergse & Meinert, 1866, and one of the lowest in the order Geophilomorpha in general.


Assuntos
Artrópodes , Quilópodes , Animais , Península Balcânica , Sérvia
6.
Zhejiang Da Xue Xue Bao Yi Xue Ban ; 53(2): 194-200, 2024 Apr 25.
Artigo em Inglês, Chinês | MEDLINE | ID: mdl-38268403

RESUMO

OBJECTIVES: To isolate a potassium ion channel Kv4.1 inhibitor from centipede venom, and to determine its sequence and structure. METHODS: Ion-exchange chromatography and reversed-phase high-performance liquid chromatography were performed to separate and purify peptide components of centipede venom, and their inhibiting effect on Kv4.1 channel was determined by whole-cell patch clamp recording. The molecular weight of isolated peptide Kv4.1 channel inhibitor was identified with matrix assisted laser desorption ionization-time-of-flight mass spectrometry; its primary sequence was determined by Edman degradation sequencing and two-dimensional mass spectrometry; its structure was established based on iterative thread assembly refinement online analysis. RESULTS: A peptide SsTx-P2 was separated from centipede venom with the molecular weight of 6122.8, and its primary sequence consists of 53 amino acid residues NH2-ELTWDFVRTCCKLFPDKSECTKACATEFTGGDESRLKDVWPRKLRSGDSRLKD-OH. Peptide SsTx-P2 potently inhibited the current of Kv4.1 channel transiently transfected in HEK293 cell, with 1.0 µmol/L SsTx-P2 suppressing 95% current of Kv4.1 channel. Its structure showed that SsTx-P2 shared a conserved helical structure. CONCLUSIONS: The study has isolated a novel peptide SsTx-P2 from centipede venom, which can potently inhibit the potassium ion channel Kv4.1 and displays structural conservation.


Assuntos
Sequência de Aminoácidos , Venenos de Artrópodes , Canais de Potássio Shal , Animais , Humanos , Venenos de Artrópodes/química , Venenos de Artrópodes/farmacologia , Dados de Sequência Molecular , Peptídeos/farmacologia , Peptídeos/isolamento & purificação , Peptídeos/química , Bloqueadores dos Canais de Potássio/farmacologia , Bloqueadores dos Canais de Potássio/isolamento & purificação , Bloqueadores dos Canais de Potássio/química , Canais de Potássio Shal/antagonistas & inibidores , Quilópodes/química
7.
Wilderness Environ Med ; 34(4): 528-531, 2023 Dec.
Artigo em Inglês | MEDLINE | ID: mdl-37453850

RESUMO

Centipede bites are reported in many parts of tropical and subtropical countries, such as India. Centipede envenomation produces significant local symptoms, with pain being the most prominent symptom. The emergency department (ED) plays a crucial role in managing the victims through appropriate pain management and control of other local and systemic symptoms. Nonopioids and weak opioids, along with local measures, are often employed, but the intense pain is often refractory to these conventional techniques. Regional anesthesia has numerous benefits over these traditional measures, such as avoidance of polypharmacy and its consequent systemic adverse effects, excellent quality of pain control, and decreased need or avoidance of hospital admission. The applications of regional anesthesia have recently increased tremendously in the ED but are unreported for the management related to centipede bites. We report a case of centipede bite in which conventional analgesics did not help, and the pain was successfully managed by low-volume selective sensory peripheral nerve block.


Assuntos
Anestesia por Condução , Bloqueio Nervoso , Animais , Humanos , Manejo da Dor/métodos , Quilópodes , Dor/tratamento farmacológico , Dor/etiologia , Bloqueio Nervoso/métodos , Serviço Hospitalar de Emergência , Nervos Periféricos , Ultrassonografia de Intervenção
8.
Toxicon ; 233: 107231, 2023 Sep.
Artigo em Inglês | MEDLINE | ID: mdl-37517595

RESUMO

Research on centipede venoms has led to the discovery of a diverse array of novel proteins and peptides, including those with homology to previously discovered toxin families (e.g., phospholipase A2s and pM12a metalloproteases) and novel toxin families not previously detected in venoms (e.g., ß-pore forming toxins and scoloptoxins). Most of this research has focused on centipedes in the order Scolopendromorpha, particularly those in the families Scolopendridae, Cryptopidae, and Scolopocryptopidae. To generate the first high-throughput venom characterization for a centipede in the scolopendromorph family Plutoniumidae, we performed venom-gland transcriptomics and venom proteomics on two Theatops posticus. We identified a total of 64 venom toxins, 60 of which were detected in both the venom-gland transcriptome and venom proteome and four of which were only detected transcriptomically. We detected a single highly abundant arylsulfatase B (ARSB) toxin, the first ARSB toxin identified from centipede venoms. As ARSBs have been detected in other venomous species (e.g., scorpions), ARSBs in T. posticus highlights a new case of convergent evolution across venoms. Theatops posticus venom also contained a much higher abundance and diversity of phospholipase A2 toxins compared to other characterized centipede venoms. Conversely, we detected other common centipedes toxins, such as CAPs and scoloptoxins, at relatively low abundances and diversities. Our observation of a diverse set of toxins from T. posticus venom, including those from novel toxin families, emphasizes the importance of studying unexplored centipede taxonomic groups and the continued potential of centipede venoms for novel toxin discovery and unraveling the molecular mechanisms underlying trait evolution.


Assuntos
Venenos de Artrópodes , Artrópodes , Animais , Quilópodes/metabolismo , Artrópodes/química , Arilsulfatases/metabolismo , Fosfolipases/metabolismo , Venenos de Artrópodes/química , Transcriptoma
9.
Integr Comp Biol ; 63(1): 34-47, 2023 07 31.
Artigo em Inglês | MEDLINE | ID: mdl-37248050

RESUMO

Feeding is a complex process that involves an integrated response of multiple functional systems. Animals evolve phenotypic integration of complex morphological traits to covary and maximize performance of feeding behaviors. Specialization, such as feeding on dangerous prey, can further shape the integration of behavior and morphology as traits are expected to evolve and maintain function in parallel. Feeding on centipedes, with their powerful forcipules that pinch and inject venom, has evolved multiple times within snakes, including the genus Tantilla. However, the behavioral and morphological adaptations used to consume this dangerous prey are poorly understood. By studying snakes with varying degrees of dietary specialization, we can test the integration of diet, morphology, and behavior to better understand the evolution of consuming difficult prey. We studied the prey preference and feeding behavior of Tantilla using the flat-headed snake (T. gracilis) and the crowned snake (T. coronata), which differ in the percentage of centipedes in their diet. We then quantified cranial anatomy using geometric morphometric data from CT scans. To test prey preference, we offered multiple types of prey and recorded snake behavior. Both species of snakes showed interest in multiple prey types, but only struck or consumed centipedes. To subdue centipedes, crowned snakes used coiling and holding (envenomation) immediately after striking, while flat-headed snakes used the novel behavior of pausing and holding onto centipedes for a prolonged time prior to the completion of swallowing. Each skull element differed in shape after removing the effects of size, position, and orientation. The rear fang was larger in crowned snakes, but the mechanical advantage of the lower jaw was greater in flat-headed snakes. Our results suggest that the integration of behavioral and morphological adaptations is important for the success of subduing and consuming dangerous prey.


Assuntos
Quilópodes , Colubridae , Animais , Comportamento Predatório/fisiologia , Crânio/anatomia & histologia , Comportamento Alimentar/fisiologia , Colubridae/anatomia & histologia
10.
Zootaxa ; 5228(4): 411-447, 2023 Jan 16.
Artigo em Inglês | MEDLINE | ID: mdl-37044645

RESUMO

The Vietnamese fauna of the genus Scolopocryptops Newport, 1844 was reviewed based on recently collected specimens and material from Zoological Museum of the Moscow Lomonosov State University (ZMMU) and Naturhistorisches Museum Wien (NHMW). As a result of study of 164 specimens from 13 sampling regions, four species have been recognized, of which S. rubiginosus C.L. Koch, 1878 and S. spinicaudus Wood, 1862 already reported from Vietnam, S. hoanglieni described as n. sp., and S. capillipedatus (Takakuwa, 1938) for the first time recorded for this country. S. broelemanni esulcata Attems, 1938 was redescribed and confirmed as a valid. The COI fragments were obtained for the above mentioned species and the K2P genetic divergence between Vietnamese Scolopocryptops species was preliminarily estimated. New data on intraspecific variations of spiracle number in Scolopocryptops, an identification key for East Asian species and the general list of species of Scolopocryptops are provided.


Assuntos
Artrópodes , Quilópodes , Animais , Vietnã , Madeira
11.
World J Gastroenterol ; 29(12): 1875-1898, 2023 Mar 28.
Artigo em Inglês | MEDLINE | ID: mdl-37032730

RESUMO

BACKGROUND: Centipedes have been used to treat tumors for hundreds of years in China. However, current studies focus on antimicrobial and anticoagulation agents rather than tumors. The molecular identities of antihepatoma bioactive components in centipedes have not yet been extensively investigated. It is a challenge to isolate and characterize the effective components of centipedes due to limited peptide purification technologies for animal-derived medicines. AIM: To purify, characterize, and synthesize the bioactive components with the strongest antihepatoma activity from centipedes and determine the antihepatoma mechanism. METHODS: An antihepatoma peptide (scolopentide) was isolated and identified from the centipede scolopendra subspinipes mutilans using a combination of enzymatic hydrolysis, a Sephadex G-25 column, and two steps of high-performance liquid chromatography (HPLC). Additionally, the CCK8 assay was used to select the extracted fraction with the strongest antihepatoma activity. The molecular weight of the extracted scolopentide was characterized by quadrupole time of flight mass spectrometry (QTOF MS), and the sequence was matched by using the Mascot search engine. Based on the sequence and molecular weight, scolopentide was synthesized using solid-phase peptide synthesis methods. The synthetic scolopentide was confirmed by MS and HPLC. The antineoplastic effect of extracted scolopentide was confirmed by CCK8 assay and morphological changes again in vitro. The antihepatoma effect of synthetic scolopentide was assessed by the CCK8 assay and Hoechst staining in vitro and tumor volume and tumor weight in vivo. In the tumor xenograft experiments, qualified model mice (male 5-week-old BALB/c nude mice) were randomly divided into 2 groups (n = 6): The scolopentide group (0.15 mL/d, via intraperitoneal injection of synthetic scolopentide, 500 mg/kg/d) and the vehicle group (0.15 mL/d, via intraperitoneal injection of normal saline). The mice were euthanized by cervical dislocation after 14 d of continuous treatment. Mechanistically, flow cytometry was conducted to evaluate the apoptosis rate of HepG2 cells after treatment with extracted scolopentide in vitro. A Hoechst staining assay was also used to observe apoptosis in HepG2 cells after treatment with synthetic scolopentide in vitro. CCK8 assays and morphological changes were used to compare the cytotoxicity of synthetic scolopentide to liver cancer cells and normal liver cells in vitro. Molecular docking was performed to clarify whether scolopentide tightly bound to death receptor 4 (DR4) and DR5. qRT-PCR was used to measure the mRNA expression of DR4, DR5, fas-associated death domain protein (FADD), Caspase-8, Caspase-3, cytochrome c (Cyto-C), B-cell lymphoma-2 (Bcl-2), Bcl-2-associated X protein (Bax), x-chromosome linked inhibitor-of-apoptosis protein and Cellular fas-associated death domain-like interleukin-1ß converting enzyme inhibitory protein in hepatocarcinoma subcutaneous xenograft tumors from mice. Western blot assays were used to measure the protein expression of DR4, DR5, FADD, Caspase-8, Caspase-3, and Cyto-C in the tumor tissues. The reactive oxygen species (ROS) of tumor tissues were tested. RESULTS: In the process of purification, characterization and synthesis of scolopentide, the optimal enzymatic hydrolysis conditions (extract ratio: 5.86%, IC50: 0.310 mg/mL) were as follows: Trypsin at 0.1 g (300 U/g, centipede-trypsin ratio of 20:1), enzymolysis temperature of 46 °C, and enzymolysis time of 4 h, which was superior to freeze-thawing with liquid nitrogen (IC50: 3.07 mg/mL). A peptide with the strongest antihepatoma activity (scolopentide) was further purified through a Sephadex G-25 column (obtained A2) and two steps of HPLC (obtained B5 and C3). The molecular weight of the extracted scolopentide was 1018.997 Da, and the peptide sequence was RAQNHYCK, as characterized by QTOF MS and Mascot. Scolopentide was synthesized in vitro with a qualified molecular weight (1018.8 Da) and purity (98.014%), which was characterized by MS and HPLC. Extracted scolopentide still had an antineoplastic effect in vitro, which inhibited the proliferation of Eca-109 (IC50: 76.27 µg/mL), HepG2 (IC50: 22.06 µg/mL), and A549 (IC50: 35.13 µg/mL) cells, especially HepG2 cells. Synthetic scolopentide inhibited the proliferation of HepG2 cells (treated 6, 12, and 24 h) in a concentration-dependent manner in vitro, and the inhibitory effects were the strongest at 12 h (IC50: 208.11 µg/mL). Synthetic scolopentide also inhibited the tumor volume (Vehicle vs Scolopentide, P = 0.0003) and weight (Vehicle vs Scolopentide, P = 0.0022) in the tumor xenograft experiment. Mechanistically, flow cytometry suggested that the apoptosis ratios of HepG2 cells after treatment with extracted scolopentide were 5.01% (0 µg/mL), 12.13% (10 µg/mL), 16.52% (20 µg/mL), and 23.20% (40 µg/mL). Hoechst staining revealed apoptosis in HepG2 cells after treatment with synthetic scolopentide in vitro. The CCK8 assay and morphological changes indicated that synthetic scolopentide was cytotoxic and was significantly stronger in HepG2 cells than in L02 cells. Molecular docking suggested that scolopentide tightly bound to DR4 and DR5, and the binding free energies were-10.4 kcal/mol and-7.1 kcal/mol, respectively. In subcutaneous xenograft tumors from mice, quantitative real-time polymerase chain reaction and western blotting suggested that scolopentide activated DR4 and DR5 and induced apoptosis in SMMC-7721 Liver cancer cells by promoting the expression of FADD, caspase-8 and caspase-3 through a mitochondria-independent pathway. CONCLUSION: Scolopentide, an antihepatoma peptide purified from centipedes, may inspire new antihepatoma agents. Scolopentide activates DR4 and DR5 and induces apoptosis in liver cancer cells through a mitochondria-independent pathway.


Assuntos
Antineoplásicos , Carcinoma Hepatocelular , Quilópodes , Peptídeos , Animais , Humanos , Masculino , Camundongos , Antineoplásicos/análise , Antineoplásicos/isolamento & purificação , Antineoplásicos/farmacologia , Antineoplásicos/uso terapêutico , Apoptose/efeitos dos fármacos , Caspase 3/metabolismo , Caspase 8/metabolismo , Linhagem Celular Tumoral , Quilópodes/química , Quilópodes/metabolismo , Neoplasias Hepáticas/tratamento farmacológico , Neoplasias Hepáticas/metabolismo , Camundongos Nus , Simulação de Acoplamento Molecular , Peptídeos/análise , Peptídeos/isolamento & purificação , Peptídeos/farmacologia , Peptídeos/uso terapêutico , Tripsina , Carcinoma Hepatocelular/tratamento farmacológico , Carcinoma Hepatocelular/metabolismo , Ensaios Antitumorais Modelo de Xenoenxerto , Camundongos Endogâmicos BALB C , Injeções Intraperitoneais , Células Hep G2
12.
J Comp Physiol B ; 193(3): 249-260, 2023 06.
Artigo em Inglês | MEDLINE | ID: mdl-36894740

RESUMO

The activity of superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GSH-Px), glutathione reductase (GR), and glutathione S-transferase (GST), as well as the concentrations of sulfhydryl (SH) groups and glutathione (GSH) were analyzed in five age classes of the Mediterranean centipede Scolopendra cingulata as follows: embryo, adolescens, maturus junior, maturus, and maturus senior. The data obtained showed the presence of SOD, CAT, GSH-Px, GR, GST, and SH groups in embryos. The transition from embryo to adolescens was accompanied by an increase in the activities of all studied enzymes, in response to the increased production of ROS due to the increased metabolic activity of the centipede associated with growth and development. Our results show that trends in antioxidant enzyme (AOE) activities were not uniform among adult age classes, suggesting that maturus junior, maturus, and maturus senior differentially respond and/or have different susceptibility to ROS. On the other hand, GSH concentration in embryos was undetectable, highest in adolescens and decreased in the latter part of life. Pearson correlation analysis in embryos showed that the activities of the AOEs were strongly and positively correlated with each other but negatively correlated with GSH and SH groups. At later age classes, SOD, CAT, GSH-Px, GR, GSH, and SH groups were no longer significantly correlated with GST. In the discriminant analysis, the variables that separated the age classes were GR, GST, SH groups, and body length. Body length was directly related to the age of individuals, clearly indicating that development/aging affects the regulation of antioxidant defense in this species.


Assuntos
Antioxidantes , Xenarthra , Animais , Antioxidantes/metabolismo , Quilópodes/metabolismo , Espécies Reativas de Oxigênio , Catalase/metabolismo , Glutationa/metabolismo , Superóxido Dismutase/metabolismo , Glutationa Peroxidase/metabolismo , Glutationa Redutase/metabolismo , Xenarthra/metabolismo , Glutationa Transferase/metabolismo
13.
J Exp Biol ; 226(4)2023 02 15.
Artigo em Inglês | MEDLINE | ID: mdl-36655810

RESUMO

Centipedes coordinate body and limb flexion to generate propulsion. On flat, solid surfaces, the limb-stepping patterns can be characterized according to the direction in which limb-aggregates propagate, opposite to (retrograde) or with the direction of motion (direct). It is unknown how limb and body dynamics are modified in terrain with terradynamic complexity more representative of these animal's natural heterogeneous environments. Here, we investigated how centipedes that use retrograde and direct limb-stepping patterns, Scolopendra polymorpha and Scolopocryptops sexspinosus, respectively, coordinate their body and limbs to navigate laboratory environments which present footstep challenges and terrain rugosity. We recorded the kinematics and measured the locomotive performance of these animals traversing two rugose terrains with randomly distributed step heights and compared the kinematics with those on a flat frictional surface. Scolopendra polymorpha exhibited similar body and limb dynamics across all terrains and a decrease in speed with increased terrain rugosity. Unexpectedly, when placed in a rugose terrain, S. sexspinosus changed the direction of the limb-stepping pattern from direct to retrograde. Further, for both species, traversal of these rugose terrains was facilitated by hypothesized passive mechanics: upon horizontal collision of a limb with a block, the limb bent and later continued the stepping pattern. Although centipedes have many degrees of freedom, our results suggest these animals negotiate limb-substrate interactions and navigate complex terrains leveraging the innate flexibility of their limbs to simplify control.


Assuntos
Quilópodes , Extremidades , Animais , Fenômenos Biomecânicos , Meio Ambiente , Locomoção , Marcha
14.
J Morphol ; 284(2): e21549, 2023 02.
Artigo em Inglês | MEDLINE | ID: mdl-36538584

RESUMO

Many species of lithobiomorph centipedes present a pronounced sexual dimorphism reflected in remarkable structural modifications on the ultimate legs of males. Most records of these male secondary sexual characters addressed taxonomy, helping to identify and characterize species or diagnose genera, but information on their diversity, detailed morphology and possible function(s) is scarce. In this study, nine species of the two lithobiid genera Lithobius Leach, 1814 and Eupolybothrus Verhoeff, 1907 were investigated, using light and scanning electron microscopy to document the detailed morphology of secondary sexual characters of male ultimate legs. Secondary sexual characters affecting the cuticle of the ultimate legs are described in detail and found to often be associated with sensilla, interpreted here as chemo- and mechanoreceptors, and with clusters of pores, a hitherto undescribed pore-distribution for this group. The tibial nodule of the species Lithobius nodulipes Latzel, 1880, was additionally examined with histological semi-thin sections. These results revealed that the clustered pores are connected to glandular tissue, and are, based on their morphology, interpreted as openings of flexo-canal epidermal glands. The presence of various sensory and glandular structures associated with sexual dimorphism indicates a likely role during courtship and mating. The closely related species examined in this research show comparable dimorphic structures, which are otherwise species-specific. Morphological observations on secondary sexual structures inform on reproductive biology in groups like lithobiomorphs for which there are limited behavioral data.


Assuntos
Artrópodes , Quilópodes , Animais , Masculino , Artrópodes/anatomia & histologia , Microscopia Eletrônica de Varredura , Epiderme
15.
Chin J Integr Med ; 29(1): 28-36, 2023 Jan.
Artigo em Inglês | MEDLINE | ID: mdl-36542225

RESUMO

OBJECTIVE: To investigate whether Leech-Centipede (LC) Granules can improve erectile function in rats with diabetes mellitus-associated erectile dysfunction (DMED) through endothelial-to-mesenchymal transition (EndMT) inhibition. METHODS: Components of LC Granules were identified via ultra-high-performance liquid chromatography. Thirty male Sprague Dawley rats were injected with streptozotocin and fed continuously for 8 weeks to establish the DMED rat model. Rats with erectile dysfunction symptoms diagnosed using apomorphine were divided into DMED and low-, medium-, and high-doses LC groups (n=6 in each). The negative control (NC, n=6) and DMED groups were given 5 mL of deionized water via intragastric gavage, and the low-, medium- and the high-doses LC groups were administered LC at 1.6, 3.2, and 6.4 g/kg, respectively, via intragastric gavage for 4 weeks. The intracavernous pressure (ICP), mean arterial pressure (MAP), and nitric oxide (NO) levels in cavernous tissue were measured for each group. Quantitative reverse transcription-polymerase chain reaction and Western blot were used to detect mRNA and protein expressions of endothelial and mesenchymal markers. Immunofluorescence staining was used to observe α-SMA, and Masson's trichrome staining was performed to determine the myofiber/collagen ratio. RESULTS: A total of 474 active components were identified. After treatment, the ICP/MAP value and NO level were significantly higher in the medium- and high-dose LC groups than in the DMED group (P<0.05). Compared with the DMED groups, the medium- and high-dose groups LC significantly increased and decreased endothelial and mesenchymal markers expression, respectively (P<0.05). Tumor growth factor (TGF)ß R II, p-Smad2, and p-Smad3 levels were considerably higher following diabetes onset but reduced following LC intervention (P<0.05), except for TGF ß 1 (P>0.05). α-SMA expression was significantly higher in the DMED group and was reduced in all LC intervention groups (P>0.05). The myofiber/collagen ratio in the LC groups was higher than that in the DMED group but lower than that in the NC group (all P<0.05). CONCLUSIONS: LC Granules may improve the erectile function of DMED rats by suppressing TGF-ß/Smad pathway to reverse EndMT.


Assuntos
Diabetes Mellitus Experimental , Disfunção Erétil , Humanos , Ratos , Masculino , Animais , Disfunção Erétil/tratamento farmacológico , Disfunção Erétil/complicações , Ratos Sprague-Dawley , Quilópodes , Diabetes Mellitus Experimental/complicações , Diabetes Mellitus Experimental/tratamento farmacológico , Diabetes Mellitus Experimental/metabolismo , Fator de Crescimento Transformador beta
16.
Ear Nose Throat J ; 102(3): NP123-NP125, 2023 Mar.
Artigo em Inglês | MEDLINE | ID: mdl-33587651

RESUMO

Arthropods may become lodged inside the ear and cause considerable emotional and physical trauma. Cases of centipedes being lodged in the external auditory canal have rarely been reported. In this article, we present the case of woman who had a centipede lodged inside her right external auditory canal. Removal using a topical local anesthetic can lead to vigorous activity of the centipede, which can cause harm to the patient and clinicians. Therefore, we developed and successfully applied a practicable method that involved using a modified plastic bottle for safe centipede removal. In conclusion, centipedes can express distinct and threatening behavior, and clinicians should pay attention to the activity of the lodged centipede and possibly use the proposed method to safely remove it.


Assuntos
Artrópodes , Quilópodes , Humanos , Animais , Feminino , Anestesia Local
17.
Zhonghua Nan Ke Xue ; 29(8): 751-754, 2023 Aug.
Artigo em Chinês | MEDLINE | ID: mdl-38619525

RESUMO

Centipede is an important traditional Chinese medicine with a long history of clinical application and a wide range of effects, and its use in the field of andrology is also expanding.In this study, the drug experience and clinical research progress of centipede in erectile dysfunction, chronic prostatitis, prostate cancer, varicocele, chronic epididymitis, epididymal nodules, functional non-ejaculation, scrotal eczema and other diseases were reviewed.


Assuntos
Andrologia , Epididimite , Disfunção Erétil , Masculino , Animais , Humanos , Quilópodes , Epididimo
18.
Zootaxa ; 5361(3): 323-344, 2023 Nov 02.
Artigo em Inglês | MEDLINE | ID: mdl-38220755

RESUMO

Three new species of the genus Newportia Gervais, 1847 from Colombia are described and illustrated. They were found in the cloud forests of the eastern Andes and in the rainforests of the biogeographical Choc, ecosystems where the centipede fauna has been little studied. Newportia (Newportia) florezi sp. nov. differs from other Newportia species in the arrangement of the spinous processes on the prefemur of the ultimate legs, while Newportia (Newportia) anopla sp. nov. has a coxopleuron without any trace of a coxopleural process and possesses an atypically small forcipular coxosternite. Newportia (Newportia) tequendama sp. nov. is morphologically similar to Newportia pusilla Pocock, 1893, but differs in having an undivided tarsus 2 in the ultimate legs and the arrangement of the spinous processes on the prefemur and femur. An identification key for the Colombian species of Newportia is provided.


Assuntos
Artrópodes , Quilópodes , Animais , Colômbia , Ecossistema , Florestas
19.
Zoolog Sci ; 39(6): 581-593, 2022 Dec.
Artigo em Inglês | MEDLINE | ID: mdl-36495493

RESUMO

The epigean centipede genus Scolopocryptops Newport, 1844 consists of two monophyletic lineages, the "Asian/North American" and "Neotropical/Afrotropical" groups. Most of the "Asian/North American" species bear the complete sulcus/sulci along the lateral margin of the cephalic plate and sternites lacking sulci, whereas Japanese Scolopocryptops elegans (Takakuwa, 1937) bears short lateral sulci on the cephalic plate and Taiwanese Scolopocryptops curtus (Takakuwa, 1939) lacks the cephalic marginal sulci, and both species bear a longitudinal sternal sulcus. The taxonomic accounts of S. elegans and S. curtus were revisited in this study based on newly collected specimens. We found that these two species share a characteristic of the second maxilla, that they lack the transparent margin on the dorsal brush, which distinguishes them from other "Asian/North American" species. Scolopocryptops elegans and S. curtus can be distinguished from each other by the characters of their antennal articles, cephalic plate, forcipular coxosternite, tergite 23, and coxopleuron. Phylogenetic analyses using nuclear 28S ribosomal RNA and mitochondrial cytochrome c oxidase subunit I sequences confirmed that S. elegans and S. curtus are closely related and form a single clade sister to a clade comprising all the other "Asian/North American" Scolopocryptops species.


Assuntos
Quilópodes , Animais , Quilópodes/genética , Filogenia , RNA Ribossômico 28S/genética
20.
Am J Case Rep ; 23: e937869, 2022 Nov 09.
Artigo em Inglês | MEDLINE | ID: mdl-36350797

RESUMO

BACKGROUND Centipede envenomation is usually mild, but a review of the existing literature revealed a more serious course in a small proportion of patients. In fact, necrotizing soft-tissue infections have been reported following centipede stings in a small number of cases and require early diagnosis and treatment because of a high mortality rate. CASE REPORT A 78-year-old man was stung by a centipede on the left abdomen. Treatment with antimicrobial agents was started due to cellulitis, but extensive erythema developed from the left chest to the left buttock. Six days after being stung, he visited our hospital. Necrotizing soft-tissue infection was diagnosed and treated immediately with antibiotics and debridement on the left side of the abdomen and chest. Group A Streptococcus was detected in the fascia. The wound was left partially open and washed daily, resulting in gradual improvement of the wound condition. On hospitalization day 8, the open wound was able to be closed. Antimicrobial therapy was completed on hospitalization day 16. The patient showed good progress. CONCLUSIONS Centipede stings are not rare in tropical and subtropical regions, and most occurrences of centipede envenomation cause only local symptoms. However, we believe that even wounds caused by centipedes should be monitored, given the possibility of subsequent severe infection, as in the present case. In addition, the causative organisms identified in the present patient with necrotizing soft-tissue infection following a centipede sting were commensal bacteria of the skin. Future research is thus needed to clarify the relationship between these causative organisms and centipedes.


Assuntos
Quilópodes , Infecções dos Tecidos Moles , Masculino , Animais , Humanos , Idoso , Infecções dos Tecidos Moles/diagnóstico , Infecções dos Tecidos Moles/terapia , Celulite (Flegmão)/microbiologia , Streptococcus pyogenes , Antibacterianos/uso terapêutico
SELEÇÃO DE REFERÊNCIAS
DETALHE DA PESQUISA
...